SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013139 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013139
Domain Number 1 Region: 1-233
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.29e-55
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0037
Further Details:      
 
Domain Number 2 Region: 313-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000207
Family FAD/NAD-linked reductases, N-terminal and central domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013139   Gene: ENSOARG00000012259   Transcript: ENSOART00000013330
Sequence length 532
Comment pep:known_by_projection chromosome:Oar_v3.1:12:36801185:36828327:1 gene:ENSOARG00000012259 transcript:ENSOART00000013330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKKVAIIGAGISGLASIRSCLEEGLEPTCFERGEDVGGLWKFSDHVEEGRASIYQSVFT
NSSKEMTCFPDFPFPDDFPNFMHNSKLQEYITMFAKEKNLLKYIQFKTIVSSVNKRPDFS
TTGQWDVITEKDGKKESAVFDAVMICSGHHVYPNIPKESFPGIKLFKGTCFHSRDYKEPG
IFKGKRVLVIGLGNSGCDIASELSHIAEKVIISSRSGSWVMSRVWDEGYPWDMLFITRFE
TFLKNTLPTVISDWWYMKQMNARFKHENYGLMPLNGALRKEPVFNDELPARILCGVVTIK
PNVKEFTEDSAIFEDGTVFKSIDCVIFATGYSYAYPFLDDSIIKSRDNEVTLFKGIFPPP
LEKPTLAVIGLVQSLGAVIPTTDLQSRWAVQVIKGTCPLPSVKDMMNDIDEKMGKKLKLF
GKSDTIQTDYVVYMDELASFIGAKPNIPWLFLTDPKLALEVYFGPCTPYQFRLVGPGKWP
GARNAILTQWDRLLKPMTTRVVGSPLKPCLFCNWFRPVLISVVSIAAFIVLF
Download sequence
Identical sequences W5PRR0
ENSOARP00000013139 XP_004013735.1.66739 XP_012042656.1.66739 XP_012042657.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]