SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013206 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013206
Domain Number 1 Region: 95-184,223-303
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 6.54e-49
Family Regulator of chromosome condensation RCC1 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013206   Gene: ENSOARG00000012325   Transcript: ENSOART00000013400
Sequence length 311
Comment pep:known_by_projection chromosome:Oar_v3.1:18:20810211:20815853:-1 gene:ENSOARG00000012325 transcript:ENSOART00000013400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEERRGTWFGFGFCGFGQALGSGLGRQVHSPEPVXAPGSALRGEPLWSHAVQEAEHGPN
RDETQAGLLPLLPCARAYVSPRPSFYRPLAPTLRARRLELGAEHALLLDAAGQVFSWGAG
RHGQLGHGTLEPEPEPRLLEALQGLRMAEVAAGGWHSVCLSETGDIYIWGWNESGQLALP
TKSLAEDGKTTAGEASGLDEDGSEVKRVSAGEDGAPAPFIAVQPFPALLDLSPGSEAVKV
SCGSRHTAVLTRTGELYTWGWGKYGQLGHKDTTTLDRPCRVEYFVDKQLQVRTVSCGPWN
TYVYAVEKEKS
Download sequence
Identical sequences W5PRX7
ENSOARP00000013206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]