SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013253 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013253
Domain Number 1 Region: 2-237
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.61e-56
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0041
Further Details:      
 
Domain Number 2 Region: 313-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.15e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013253   Gene: ENSOARG00000012370   Transcript: ENSOART00000013447
Sequence length 534
Comment pep:known_by_projection chromosome:Oar_v3.1:12:36849580:36878153:1 gene:ENSOARG00000012370 transcript:ENSOART00000013447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ATMVKRVAIIGAGVSGLASIRCCLEEGLEPTCFERSNEVGGLWEFSDHSEEGRASIYKSV
FTNSSKEMMCFPDFPYPDDYPNYMHQSKVQDYIKTFAQKKNLFRYIQFETLVTSIKKCPN
FLITGQWEIVSEKDEKQESTIFDAVMICSGHHVYPNLPTDSFPGLDRFQGYYLHSRDYKG
PEVYQGKRVLVIGLGNSGCDIAVELSRLVTQVIISTRSGSWVMSRVWDDGYPWDMLYVTR
FASFLRNALPSFVSDWLYVKKMNKWFKHENYGLMPLNSTLRKEPVFNDELPSRILCGTVS
IKPNVKEFTETSAVFEDGTVFEAIDYVIFATGYGYAYPFLDDSIIKSRNNEVTLFKGIFP
PFLEKPTLAVIGLVQSLGAAIPTADLQARWAVKVFANSCTLPTTNEMMDDIEEKMGKKLK
WFGQSQTLQTDYITYMDELGSFIGAKPNIPWLFLTDPQLALEVYFGPCSPYQFRLMGPGK
WDGARNAILTQWDRTLKPTRTRAVSEAKRPQPFYNLLKILLFPVLLLAALLAFH
Download sequence
Identical sequences W5PS24
ENSOARP00000013253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]