SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013418 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013418
Domain Number 1 Region: 64-308,416-477
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-41
Family FAD-linked reductases, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013418   Gene: ENSOARG00000012522   Transcript: ENSOART00000013615
Sequence length 486
Comment pep:known_by_projection chromosome:Oar_v3.1:21:28852528:28860168:1 gene:ENSOARG00000012522 transcript:ENSOART00000013615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRALRLRLGQCLSGRGLGTYRGGSTLDCDGKVSKIKKKIQSIFPGRAWSPLYDTSHLP
PERSDVVIVGGGVLGLSVAYWLKRLEKQQGAIQVLVVERDHTYARASTVLSVGGIRQQFS
LPENVQLSLFSAEFLRNINEYLAVVDDPPLDLQFNPSGYLLLASEEGAAIMERNVKIQRQ
EGAKVCLMSPEQLQKKFPWINTEGVALASYGLENEGWFDPWCLLQGLRRKLQSMGVLFCQ
GEVTRFISSSSHMETASGEQVTLKRIHEVHVKMDHSQEFQPVECALVVNAAGAWSGQIAE
LAGVGTGPPGTMQGTKLPVEPRKRYVYLWHCPQGPGLEAPLVADPSGAYFRREGLGNNYL
GSCSPTEEEEPDPGNLEVDYDFFQEKVWPRLAQRVPAFETLKVRSAWAGYYDYNTFDQNG
VVGPHPLVINMYFATGFSGHGLQQAPAVGRAVAEMMLEGHFQTINLSPFLFGRFYFGEKA
QEHCIL
Download sequence
Identical sequences W5PSI9
XP_004019579.1.66739 ENSOARP00000013418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]