SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013444 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013444
Domain Number 1 Region: 26-133
Classification Level Classification E-value
Superfamily Immunoglobulin 4.46e-17
Family V set domains (antibody variable domain-like) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013444   Gene: ENSOARG00000012547   Transcript: ENSOART00000013642
Sequence length 220
Comment pep:novel chromosome:Oar_v3.1:11:55854038:55874365:1 gene:ENSOARG00000012547 transcript:ENSOART00000013642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPRGRAGWLPSALLLLQLPGCLSLSGPRSVTGIVGGSLRVECRYQEAFVDEIKYWCKHP
CVSPWKIVETRESEREVRRGRVSIRDRPASLTFTVTLESLREEDAGTYGCGIYVPLSRDP
TFQVEVSVIPAPATATSTERSTGSPGSPTTLPVPTWSTASGQETPDPSQPPRPLLGSAHF
LLLVFLKVPLLLGMLGAVLWVHRPLRSSADRQSQSIYENQ
Download sequence
Identical sequences W5PSL5
ENSOARP00000013444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]