SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013498 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013498
Domain Number 1 Region: 3-216
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.27e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.01
Further Details:      
 
Domain Number 2 Region: 159-331
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.24e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.017
Further Details:      
 
Domain Number 3 Region: 305-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000734
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013498   Gene: ENSOARG00000012597   Transcript: ENSOART00000013698
Sequence length 532
Comment pep:known_by_projection chromosome:Oar_v3.1:12:36976494:37004901:1 gene:ENSOARG00000012597 transcript:ENSOART00000013698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRVAIVGAGVTGLASIKCCLEEGLKPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVS
NSCKEMSCYPDFPFPEDYPNYVPNSLFLDYLKMYANRFNLLECIQFKTKVCSVRKRPDFT
ATGQWEVVTLCEGRQESAIFDGVMVCTGYLTNPYLPLDSFPGINTFKGQYFHSREYKHPD
IFRDKNVLVIGMGNSGTDIAVEASHLAKKVFLSTTGGAWVISRVFDSGYPWDMVFMTRFQ
NTFRNSLPTPIVNWLIARRMNSWFNHANYGLIPEDRVQLREPVLNDELPGRIITGKVLIK
PRIKEVKENSVVFSNTPKEEPIDIIVFATGYTFAFPFLDETIVKVEDGQASLYKYIFPAH
LPKPTLAVIGLIKPLGSLLPTGDTQARWAVRVLKGVIKLPPSSIMIEEVNERKQNKPSGF
GLRYCKALETDYITYVDELLTAINAKPNLFSLLLTDPRLALAIFFGPCTPYQFRLTGPGK
WEGARNAIMTQWDRTFKATKTRIVQESPSLFASLLKLFSFLALLVAIFLIFL
Download sequence
Identical sequences W5PSR9
XP_004013739.1.66739 XP_011966804.1.54773 ENSOARP00000013498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]