SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013510 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013510
Domain Number 1 Region: 438-578,616-940
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.25e-51
Family Tandem AAA-ATPase domain 0.017
Further Details:      
 
Domain Number 2 Region: 208-264
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000615
Family F-box domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013510   Gene: ENSOARG00000012605   Transcript: ENSOART00000013710
Sequence length 1046
Comment pep:known_by_projection chromosome:Oar_v3.1:13:10382197:10419393:1 gene:ENSOARG00000012605 transcript:ENSOART00000013710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRFKRKHLTAIECQHLAQSHLAASQSFGQRWTSRDPNHGLYPRPRTKRGTRGRGCLRYS
RDFFLAGQQQCTNDMAKSNSVGQDSPKDSEDEMIFEAGSPCALPPGGDGDTRLHSPGSAL
PARKRSRSLEDERNPAPGTSPWDGVSKKTPWHHSSPSCTRPREASPEAEVGVGQLSVQPG
EPSQEVEDIGPDPVPDPHYGLLGTLPCQEPPSHICSLPSEVLRHIFAFLPVEDLYWNLSL
VCRLWREVISDPLFIPWKKLYHRYLMNEEQAVNKVDGILSSYGIEKESDLCVLNLIRYTA
TTKCSPSVDPGQALWSLRDHLLLPEAEACVRQHLPDLCAAPAGINVWALVAAIVLLSSSV
SDIQQLLFCLRRPSSTVTVPDATETLYCLAVLLYAMREKGVSISNRIHYNIFYCLYLQEN
SCAQASGDKEEPSVWSGKKTTIQLTHEQQLILSHKMEPLQVVKIMAFAGTGKTSTLVKYA
EKWSQSRFLYVTFNKSIAKQAELVFPSNVICKTFHSMAYGHIGRKYQLKKKLNLFKLTPF
MVNSVLTEGKGGFIRAKLVCKTLENFFASADEELTIDHVPIWCKNSQGQRVMVEQSEKLN
GVLEASRLWDNMRKLGECKEEAYHMTHDGYLKLWQLSKPLLASFDAIFVDEAQDCTPAIM
NIVLSQPCGKIFVGDPHQQIYTFRGAVNALFTVPHTHVFYLTQSFRFGVEIAYVGATILD
VCKRVRKKTLVGGNHQSGIRGDSKGQVALLSRTNANVFDEAVRVTEGEVPARIHLIGGIK
SFGLDRIIDIWTLLQPEEERKKRNLVIKDKFIRRWARKEGFSGFKRDVTAAEDKELEAKI
AVVEKYNIRLPELVARIERCHIEDLDFAEYILGTVHKAKGLEFDTVHVLDDFVKVPCARH
NLAQLPHFRVESFSEDEWNLLYVAVTRAKKQLIMTRSLENILTLAGEYFLQAELTSNVLK
TGVVRCCVGQCSNAIPVDAVLTMRKLPITYSNRKENKGGYLCHSCVEQRIGPLAFLTASP
EQVRAMDRTVENVVLPRHEALLFLVF
Download sequence
Identical sequences W5PST1
XP_004014220.1.66739 ENSOARP00000013510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]