SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013551 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013551
Domain Number 1 Region: 91-170
Classification Level Classification E-value
Superfamily Ribosomal protein S18 7.72e-25
Family Ribosomal protein S18 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013551   Gene: ENSOARG00000012647   Transcript: ENSOART00000013751
Sequence length 258
Comment pep:known_by_projection chromosome:Oar_v3.1:20:27432318:27439013:-1 gene:ENSOARG00000012647 transcript:ENSOART00000013751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASILNVLLRRLPNISPFRGAYGVQVPLQTLCTKAPPEDDSLPPIPVSPYEDEPWKYLD
SEEYHNRYGSRPVWADYRRNHKGGIPPQRTRKMCIRGNKVAGNPCPICRDQKLHVDFRNV
KLLKQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARDHGLLSYHIPQVEPRDLDFSTS
HGAVSATPPAPTLVSGDPWYPWYSWKQPPERELSRLRRLYQGHLREESGPPPESMPKVPL
TAPTEATSTEQAGPQSAL
Download sequence
Identical sequences W5PSX2
ENSOARP00000013551 XP_004019040.1.66739 XP_012019786.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]