SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013565 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013565
Domain Number 1 Region: 19-145
Classification Level Classification E-value
Superfamily Lysozyme-like 8.04e-45
Family C-type lysozyme 0.0000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013565   Gene: ENSOARG00000012661   Transcript: ENSOART00000013766
Sequence length 156
Comment pep:novel chromosome:Oar_v3.1:X:53491095:53493251:1 gene:ENSOARG00000012661 transcript:ENSOART00000013766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQVSGTIVVILMAANVEAKIYERCDLAKKLEAAGLNGFNGYTIGDWLCMAHYESGFDTSF
MNHNPDGSSEYGIFQLNSAWWCYNGVTPSENLCHMDCHELLNRHILDDIMCAKKVVSSEN
GMSAWDSWNQHCYGHDLSEWLRGCHMNAKPNKKVIS
Download sequence
Identical sequences W5PSY6
ENSOARP00000013565 XP_004022181.1.66739 XP_012027537.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]