SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013576 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013576
Domain Number 1 Region: 546-576,714-788
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000549
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013576   Gene: ENSOARG00000012670   Transcript: ENSOART00000013777
Sequence length 960
Comment pep:known_by_projection chromosome:Oar_v3.1:20:10004712:10077705:-1 gene:ENSOARG00000012670 transcript:ENSOART00000013777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPDRSFQSFASRYRQSSFTYDVKRDVYNEENFQQEHRKKTASSGNADIDISTVSHHVEC
RCSWYKFQRCLLTVFPFLEWMCFYRFKDWLLGDLLAGISVGLVQIPQVLMLGLLARHLIP
PLNVSYAAFCASVIYGIFGSCHQMSIGTFFLVSALTINVLRTEPFNSGHLLLGTFIQDDF
SNITFYENYNRSLSSVASVTLLTGIIQLSMGMLGFGFIVTYIPEAAISGYLAATALHVML
SQLTCIFGVMISYNSGPIAFFYNIINYCLGLPKANSTSILLFLTTIVALRINKCIRICFN
QYPIEFPMEVFLILGFAAFSNKVNMATENSLMLIEMIPYSFLFPVTPDMSNLTEVLAESF
SLALVSSFLLIFLGKKIASFHNYDVNSNQDLIAIGLCNVVSSFFRSYVFTGAVARTIIQD
KTGGRQQFASLVGAGLMLLLMMKMAHFFYKLPNAIVAGIILSNVLPYLEVVYTLPSLWRQ
NQYDCLIWMVTFMSAILLGLDIGLVVAVTFAFFIITVQSHRTKILLLGQIPNTNIYRSFQ
DYREVANIPGVKIFQCCNAITFVNVHYLKRKVLEEIEMVKMPLTDEEIYTLFSPNEEGAQ
RGKICRCYCNCDEPEPLPRVIYTERYEVQRGRESSFINLVRCSRFESMDTGQSISEDQVP
YITSSSSQRNPNYEEVEKVWLSDDPSRSMTITLPEASDTQVRATKLLPYSTSTVLPSVHT
IILDFSMVHLVDAQALVVLRQMFCAFQNANILVLIAGCHSFVVRSLEKNDFFNAGITKAQ
LFLTLHDAVLFALSRKLPESSELSVDESETVIQETFSETDKKEESRHKTSRSFIEAPRSK
SPAFSLLPDPEMEEESNLDLYSTIQMSKDHGLDLDLDLDREVEPESELEPESELDQETEL
EPDPEASHKPTRQKYWSLFRAIIPRSPTHTQARTQSVDRRHQNVKPYTSKADTSEDALEI
Download sequence
Identical sequences W5PSZ6
ENSOARP00000013576 XP_004018826.1.66739 XP_011967335.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]