SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013675 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013675
Domain Number 1 Region: 23-89
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.0000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013675   Gene: ENSOARG00000012768   Transcript: ENSOART00000013879
Sequence length 277
Comment pep:known_by_projection chromosome:Oar_v3.1:13:10429562:10448119:-1 gene:ENSOARG00000012768 transcript:ENSOART00000013879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSIPQSKLQSADIFPLIYTSVGITCPTPTSVEHADIQVKNYSINSRERYVCNSGFKRKAG
TSSLTQCVFNETAKVAHWTTPNLKCIRDPSLSHQRPPSTAAPTGLTPEPESPTPSGKEPD
LTSKSDTKVATRPATGPGSRLPSTAPPVGTTGVVSKETTYVPAQTAAKAPEYTHPALQDT
PGAYQHNPSVVTAAVSIPVAVVFAVCLVFLLVRCLMSRRAHQTPGVEMESMESVPMTTGA
DARGEDTETHLYGLGGSGDAEASSRGEGPALPQPERT
Download sequence
Identical sequences W5PT94
ENSOARP00000013675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]