SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013693 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013693
Domain Number 1 Region: 36-159
Classification Level Classification E-value
Superfamily Prefoldin 8.63e-20
Family Prefoldin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013693   Gene: ENSOARG00000012787   Transcript: ENSOART00000013898
Sequence length 166
Comment pep:known_by_projection chromosome:Oar_v3.1:X:53753300:53759852:1 gene:ENSOARG00000012787 transcript:ENSOART00000013898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLPIPQEPIMATPPKRRAVEATAEKVLRYEAFISDVLQRDLQKVLDHRDKVYEQLAKYL
QLRNVIERLQEANHSELYMQVDLGCNFFVDTVVPDTSRIYVALGYGFFLELTLAEALKFI
DRKSNLLTELSDSLTKDSMNIKAHIHMLLEGLRELQGLQNFPETQH
Download sequence
Identical sequences W5PTB2
ENSOARP00000013693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]