SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013776 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013776
Domain Number 1 Region: 116-179
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000162
Family Complement control module/SCR domain 0.00021
Further Details:      
 
Domain Number 2 Region: 17-73
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000111
Family Complement control module/SCR domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013776   Gene: ENSOARG00000012860   Transcript: ENSOART00000013981
Sequence length 271
Comment pep:novel chromosome:Oar_v3.1:13:10486689:10500391:-1 gene:ENSOARG00000012860 transcript:ENSOART00000013981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FIPQLNPWGFPRCPAEACHDDPPSLRNAMFKVLRYEVGTMINCDCKAGFRRVSAVMRCVG
DSSHSAWNNRCFCNSTSPAKNPVKPVTPGSEEQRERKPTDAQSQTQPPEQADLPGHCEEP
PPWEHEREPLKRVYHFTLGQTVHYQCAQGFRALHTGPAESTCTMIHGEMRWTRPRLKCIS
EGANSQAPDEAEPPESTEAPPGSGTFLTTRMAGTTDFQKPTDVVATLDTFIFTTEYQIAV
AGCILLLSSISILLLSCLTWQRRWKKNRRTI
Download sequence
Identical sequences W5PTJ5
ENSOARP00000013776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]