SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000013793 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000013793
Domain Number 1 Region: 136-183
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000641
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 256-307
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000131
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 3 Region: 188-248
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000106
Family TSP-1 type 1 repeat 0.00055
Further Details:      
 
Domain Number 4 Region: 76-131
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000562
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 311-371
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000471
Family TSP-1 type 1 repeat 0.00096
Further Details:      
 
Domain Number 6 Region: 379-414
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000366
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000013793   Gene: ENSOARG00000012877   Transcript: ENSOART00000013998
Sequence length 463
Comment pep:known_by_projection chromosome:Oar_v3.1:X:53781130:53786565:1 gene:ENSOARG00000012877 transcript:ENSOART00000013998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAQVQALLLLLLLPLLLLTPATGSDSVLCFAQYEESTGKCKDLLGGGVSMKNCCLNANY
AFQKPGSKLCMACRLPQWSPWSTWTPCSVTCTEGSQLRHRHCIGWDDQCLPEKVEPGTLQ
WQLQACEDQPCCPEMGGWSDWGPWTACSVTCSGGTQIRRRACNRPTPKCGGHCTGEAQES
KACETKQVCPTHGAWAAWGPWGPCSGTCQGGPNAAVERRSRTCSAPEPSTQPPGNPCPGS
AYEQRVCTSLPPCPVAGGWGPWGAVSPCPVTCGLGQIQEQRTCDHPVPQHGGPFCVGDAT
RTHVCNTAVHCPVNGQWGLWGEWSNCIRPNIKHISCQEIPGQQTRSRICKGRKFDGQRCV
GKQQDIRHCYNIQRCPWKGSWSEWSTWGLCIPPCGPNPIRTRQRLCQATLPKFSPTVTTV
EGQGEKNVTFWGKPSVLCDVLQGQKVMVEEKRPCLHVPPCKEP
Download sequence
Identical sequences W5PTL2
XP_004022176.1.66739 ENSOARP00000013793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]