SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014001 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014001
Domain Number 1 Region: 3883-4008
Classification Level Classification E-value
Superfamily SEA domain 2.22e-43
Family SEA domain 0.00019
Further Details:      
 
Domain Number 2 Region: 3498-3622
Classification Level Classification E-value
Superfamily SEA domain 1.31e-41
Family SEA domain 0.00019
Further Details:      
 
Domain Number 3 Region: 3654-3777
Classification Level Classification E-value
Superfamily SEA domain 1.57e-39
Family SEA domain 0.00013
Further Details:      
 
Domain Number 4 Region: 3337-3465
Classification Level Classification E-value
Superfamily SEA domain 3.01e-38
Family SEA domain 0.0002
Further Details:      
 
Domain Number 5 Region: 4017-4140
Classification Level Classification E-value
Superfamily SEA domain 9.81e-37
Family SEA domain 0.00031
Further Details:      
 
Domain Number 6 Region: 4335-4459
Classification Level Classification E-value
Superfamily SEA domain 1.57e-36
Family SEA domain 0.00031
Further Details:      
 
Domain Number 7 Region: 4587-4708
Classification Level Classification E-value
Superfamily SEA domain 6.8e-35
Family SEA domain 0.0000063
Further Details:      
 
Domain Number 8 Region: 4152-4192,4223-4305
Classification Level Classification E-value
Superfamily SEA domain 1.83e-32
Family SEA domain 0.0004
Further Details:      
 
Domain Number 9 Region: 3812-3874
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000000418
Family SEA domain 0.0032
Further Details:      
 
Domain Number 10 Region: 4468-4574
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000000445
Family SEA domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014001   Gene: ENSOARG00000013067   Transcript: ENSOART00000014208
Sequence length 4781
Comment pep:known_by_projection chromosome:Oar_v3.1:5:11113459:11229292:-1 gene:ENSOARG00000013067 transcript:ENSOART00000014208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRKDPAYPGCHQRGHLVALTLSFFLTCWPGSVATTTTDLEEPGGTTQPMGSFTSLKTIS
LVLTSDLRKTTEVLGTSLEPVTSTPESVTNISQEILTSSEATSDTETTHSSRITAVTDMG
ITSSANTEPPEATSAMVFSSTRRDTSVSTSTPDSSKTAQIETEPTSSLTAGPRDTSTHQE
ESLSRDLSKNTAVTNMRTTDDKHESRSFVSTDSEPSKTVFPMNTAITIGKTTVSTPMSSF
SETPRIEAETSSSLMFEMRETSTSKETSSSTDKTTILPDMNTGSVTEVARTEDISSGGVL
SKSPAISTMSPVISTETITRLSTFPTMTESTEITVTIEQGHPAATSQRTLDWDTPTTTSM
VGTNTAVTQGLLHTALMTPMSTGAQERSPSSPPPVTSLLTHGLVKTTDTLGTGLGSVTSL
PSIEISSTTELLSTSGVSTSTEVIQPSKNIARTHGANTSSGPEAHSSTPADSEPSNVTSQ
TVTPTISRENPVSTPVPHSTETTMIETASTSSLSPELRETSAIPQNSSTTEKITLLSKVP
TDTTAELSKTQPISSTSMSSPGPTQSTVSPDTPAGIITSLSTSPVTTESAELVITSQTGP
SEVTSQGTLTLNTATEASGAGTHPAVTQSFTHSEMSTLMSRGPQDVSWTSPASVEETSSP
PSPVTLSAVTSPSPESPTLPGRSPSSPPPVTSLLTHGLVKTTDTLGTGLGSVTSLPSIEI
SSTTELLSTSGVSTSTEVIQPSKNIARTHGANTSSGPEAHSSTPADSEPSNVTSQTVTPT
ISRENPVSTPVPHSTETTMIETASTSSLSPELRETSAIPQNSSTTEKITLLSKVPTDTTA
ELSKTQPISSTSMSSPGPTQSTVSPDTPAGIITSLSTSPVTTESAELVITSQTGPSEVTS
QGTLTLNTATEASGAGTHPAVTQSFTHSEMSTLMSRGPQDVPSTSPASVEETSSPPSPVT
LSAVTSPSPESPTLPGRSPSSPPPVTSLLTHGLVKTTDTLGTGLGPVTSLPSIEISSTTE
LLSTSGASTSTEVLQPSKSTTRTHGVHTSSGPEVHSSTPADSEPSSVSSPIVPFSTSRET
AVATPMPHSTETMTVETASTSSQSPELRETSTIQQNSSTTEEITLLSKVPTDTTTELSKT
QPISSSSTFIPSPTQSAVSPDTPAGIITSLPTSPMTTESAEMTITSQTGLPEATSQGTLT
LDTSTSSPSASVHSSAMTSPSLQFPIVPGTSPSSPTPATSLLTSSLMNTTEKLDTIFKPV
TTSPPPLSSPIMETLSTSEFSTDTVKIPPSIHTTVTTEGSSNSGHELSSSGSNFSESSRI
TYPASSTDGITLSTSKPSSFETTAFETNKLSHLTPGLKETSMTLHFSSSSLTNTPPSALS
TYGLKSPKMDVTSSVTSSAPVQSLSTQDTDVPVKTVTHFNASPSVNGSAGITLPESSLSM
PVSANTHHLHTDTLSSAETTLANTLTSPVSAAMASFATSGVPGAISATSSDGPFSRTESD
PKGDTRSTTADGLPSSASTPFPSSTLHTTDPSVSSLSHWITSSPATPSTVDTNLDTESRR
TSELPLVTTSTLQAWSQPYWTSLPPIMDTKMTGSVGLGRVTSSSQVIPHSTQSTRTDDIV
KHITKTPNKAAHGGTTIHTPQAPTSASLTDKKASTSTIGTIITTPDSPKMTASLTIRPGD
ETSTTVPMTTPSIFSRGPETTPSLVPSSGAETSAAVPILTVSSDEPETTNSWVTHPAETS
STVSRAIFNISISHSESDSTPPTTTSSGKEVSTAVPTPTVSREVLGMVTSLVASPGTETS
SADQTLAVSPETSTPDSKTTMNFSPRELDTTSSSKPVMVTSLVISSGTDTSTTFPTLTGF
PHELESTVSLVTQPPESDPTVSKTMPISHNESDTMLSVVTSLGAKVSSAVPTTTVSPGVS
GMVTSLVTSSTAETSSTSPTLTGSLHEPETTASWVTHSERKVSSTVPTMTVFPEKSDTTV
SFITHPEETSPTVPRKTSNVSHSESNTTFSVATSPGEEFSSAVPATTVSPAVSGIVTSQV
TSSVAQTSTTFPTVTDSMTILPGKPDTTVSLVTHPEETSLNIPRTTPNVSQSEFDTTPSI
ATSPGAEGSSSVPAMTTSPGIPEMMTSLITSSVAEASTTFPTLTDSTHKPETTASGITHS
GTETSTAVPTMTVSPEKPNTTISVATHPEETSPTLPRTTPSVSHTETDTTFSTATSPGTE
SSSAIPATTVSPSVTKLVTSLVTGSGEEISTTLPTLTASPGQMETTASWPKTTASLVTHP
GVQASSATSVVFSTMPSKSDITPSMATSSEAEASSAIPTTAISPSVPDVMTSLITTARAE
ISTTFRTMTDSTHEPEATALAVTHSGTKTNSAILTMTVSPGKPDTTVSLVTHSEETSHTV
PRTTSSVSQGESDTTPSMTTSPAAEVSSAVPAMTVPPSTGTKASSAVPTFPILTDSTHKP
ETTASEVTHSGKETSSAISKISTTFPILTDSTHKPETTASEVTHSGKETSSAISTMTVSA
GKPDTTVSLVTHSEETSPTVPRTTFKVSQSESDTTLSTATSPGTETSSALPATTVSPGVS
GMVTSLVTNSVTEISTTFPIQTNSTLKPETTASGVTQIETSSAVPILIVSPRKPDTTVSL
VTHPEETSHTVPRTTFKVSQSESDTTLSTATSPGTETSSALPATTVSPGVSGMVTSLVTN
SVTEISTTFPTRTNSTLKPETTASGVTQNETSSAVPILTVSPGNESDTTPSTATSPGTET
SSAVPATTVSPGKPDATVSLVTHPEETSPTVPRTTSKVSQSESDTTPSTATSPGTETSSA
VPATTVSPGVSGMVTSLVTNSVTEISTTFPTRTNSTLKPETTASGVTQNETSSAVPILTV
SPGKPDATVSLVTHPEETSPTVPRTTSKVSQSESDTTPSTATSPGTETSSAVPATTVSPG
VSGMVTSLVTNSVTEISTTFPTRTNSTLKPETTASGVTQTETSSAVPILIVSPGKPDATV
SLVTHPEETSPTVLKTTPSISHSESDTTPSTATRPGTETSSAVPATTVSPGLPDTVSSET
DTTMAILPLTLSPGEPATTALLVTSSSAETSTTSASAVFPHLPETTASPSFWPELETSAA
PPSQTVSLRRPGTSAFFTMPVTVIAGAALNPTVSLGVSSATASVPTGEAELSTATAAPAT
SHGLPETTGFLATSPEAQASTSLPAPTLSPGGLGPPRTSATTVELYPVTAGNTETSPPAT
SVELSEFPKTVTGDTVTLRPSETTMQPKTSHVEGVRTTTILKTATVETTHLAATGSSPTV
AETTTTLNTLAGSPFARVTTPGTSTLASVTVTSGTTTAAAIPFLMPFTVNFTITNLRYTE
DLGNSDSKIFKDTERRLQLLLRPLFRNSSIGSRYAGCRLTLLRADKGETSTRMDAVCTYR
SDPTGFRLDTERLYRELSQQTQGVTRLDHYTLDRNSLYVNGYNHRYWIPTTSTPATSTFS
PGPPAFPTSIPSSTVADMGPALMPFTLNFTITNLFYTPDMGHRGSEKFNFTEKVLNHLLG
PLLKNTSVGPLYSNCRLTLLRTEKDGAATGVDAICTYHPDPTRPGLDREKLYRELSQLTH
GVTRMGNYTLDSNSLYVNGYSRQYWMPTTSTPVTSTFSLESSTSLSPILRSTGMSPSLVP
FTLNFTITNLNYTEDMSPPGSELFSTMERILNRLLKPLFQNSSIGLLYSGCRLTLLRPEK
HRRATGVDAVCTHRPNPMGPKLDRERLYRELSHETHGVTQLGSFTLDKHSLYVNGYTQWT
SASTPSGVAKRGRAGWTDGELVEPTIWRFLHRPEKDGTATRVDAICMHRPDPKGPGLDRE
QLYWELSHLTHGVTLLGPYTLDRDSLYVNGYTHQALNSTPSIASPALVPFTLNFTINNLH
YVEDMHRPDSWNFNNTERVLQVLLRLLFKNTRVGHQYSGCRLTSLRPEKNGAATGVDAVC
THRPDPVGPGLDREQLYWELSQLTHGVTQLGPYTLDQDSLYVNGYSHRTSATTANTPDLH
LVSFTLNFTITNMHYTEDMGRPSSLKFSATERILQHRLRVLLSKTSVGPLYAGCRLELLR
PEKRGAATGVNVVCSLRSEPARPALNEQQLYWELSRETGGITQLDSFSLDRNSLYVNGYT
YAALAPTTTTGEVSEEPFTLNFTINNLRYSADMGHPGSHKFNITDTLMQHLVRCQLHSPR
CAPLVDQRPHVTTNGSLLPLQLSPLFQRSSLSARYAGCRVISLRSVKNGAKTRVNILCTY
RRSPSGPSLLAKKVFHELSRQTHGITRLGPYSLDKDSLYLNGYNERGPDEPPTTPAPATT
FLPTSPSPVQPESTTAMGYNLKTLTLNFTISNLPYSSDMSNGSAMFNSTKMILHHLLGSL
FQKSSLGPFYSGCRLISLKPEKDGAATSVYVVCTYHPDPTGHRLNIEQLYWELSQLTHGV
TQLGFYTLVKDSLFINGYAPQSLSLQREYQLNFHIINWNLSNPDPTSSEYIALLWDISDK
VTKLYRSSQLQDVFLSCLVTNLTLDPISVTIKAQFSSRVDSSMVKQVFLDKTLNASSHWL
GATYQLTDVHVTEVEPSIHLPTDQSTISPNFQEVQLNFTVTNLFYSQDMKQPDTPKYQRN
KRNIEDALNQLFRNSSIKTHFSDCEVSAFRSVPPSNHTGVNAQCNFAFLARSLNRVVIYE
EFLRLTKNGTQLQNFTLDRNSLLVDGYSPNRNDVVTENSDLPFWAIILICLAGLLVLIMG
LIGFFLARVHQRKKEADYEVQQLQPDSVGYYLPHLDLRKLQ
Download sequence
Identical sequences W5PU70
ENSOARP00000014001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]