SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014028 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014028
Domain Number 1 Region: 103-416
Classification Level Classification E-value
Superfamily RNI-like 1.41e-46
Family Cyclin A/CDK2-associated p19, Skp2 0.0062
Further Details:      
 
Domain Number 2 Region: 41-91
Classification Level Classification E-value
Superfamily F-box domain 1.7e-17
Family F-box domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014028   Gene: ENSOARG00000013099   Transcript: ENSOART00000014235
Sequence length 425
Comment pep:known_by_projection chromosome:Oar_v3.1:16:57116275:57127160:-1 gene:ENSOARG00000013099 transcript:ENSOART00000014235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSDLSMRTLSTPSPALICPPNLPGFQNGGLPHPLIRLASRPQKEQASIERLPDHAMVQVF
SFLPTNQLCRCARVCRRWYNLAWDPRLWRTIRLTGETINVDRALKVLTRRLCQDTPNVCL
MLETLSVSGCRRLTDRGLYTIAQCCPELRRLEVSGCYNISNEAVFDVVSLCPNLEHLDVS
GCSKVTCISLTREASIKLSPLHGKQISIRYLDMTDCFVLEDEGLHTIAAHCTQLTHLYLR
RCVRLTDEGLRYLMIYCASIKELSVSDCRFVSDFGLREIAKLESRLRYLSIAHCGRVTDV
GIRYVAKYCGKLRYLNARGCEGITDHGLEYLAKNCAKLKSLDIGKCPLVSDTGLECLALN
CFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDCEVSVEALRFVKRHCKRCVIEHT
NPAFF
Download sequence
Identical sequences W5PU97
ENSOARP00000014028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]