SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014152 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014152
Domain Number 1 Region: 256-458
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.63e-47
Family Reprolysin-like 0.0021
Further Details:      
 
Domain Number 2 Region: 550-605
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000471
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 3 Region: 969-1015
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000654
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 4 Region: 908-966
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 5 Region: 846-904
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000118
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014152   Gene: ENSOARG00000013204   Transcript: ENSOART00000014359
Sequence length 1202
Comment pep:known_by_projection chromosome:Oar_v3.1:6:87097877:87386270:-1 gene:ENSOARG00000013204 transcript:ENSOART00000014359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLSLWLIAAALVEVKTSADGQAGNEEMVQIDLPIKRQREYELVTPVSTNFEGRYLSHI
LSANHKKRSTRDVSSNSEQLFFNITAFGRDFHLRLKPNTQLVAPGAVVEWHEASPVPGNI
TDPINDHQPGSTSDRIWKTEPLQTNCAYVGDIMDVPGTSVAISNCDGLAGMIKSDNDEYF
IEPLERGKQMEEEKGRIHVVYKRSAVERAPIDMSQDFHYRESDLEGLDDLGTVYSSIDQQ
LNETMRRRRHAGENDYNIEVLLGVDDSVVRFHGKEHVQNYLLTLMNIVNEIYHDESLGVH
INVVLVRMIMLGYAKSISLIERGNPSRSLENVCRWACQQQKSDPNHSEHHDHAIFLTRQD
FGPAGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDETA
MGSVMAPLVQAAFHRYHWSRCSGQELKRYIHSYDCLLDDPFEHDWPKLPELPGINYSMDE
QCRFDFGVGYKMCTAFRTFDPCKQLWCSHPDNPYFCKTKKGPPLDGTECAAGKWCYKGHC
MWKNANQQKQDGNWGSWTKFGSCSRTCGTGVRFRTRQCNNPAPINGGQDCPGVNFEYQLC
NTEECQKHFEDFRAQQCQQRNSHFEYQNTKHHWLPYEHPDSKKRCHLYCQSKETGDVAYM
KQLVHDGTRCSYKDPYSICVRGECVKVGCDKEIGSNKVEDKCGVCGGDNSHCRTVKGTFT
RTPRKLGYLKMFDIPPGARHVLIQEDEASPHVLAIKNQATGHYILNGKGEEAKSKTFIDL
GVEWDYNIEDDIETLHTDGPLHDPVIVLIIPQENDTRSSLTYKYIIHEDSAPTINSNNVI
QEELDTFEWALKSWSQCSKPCGGGFQYTKYGCRRKSDNKMVHRSFCEVNKKPKPIRRICN
IQECTHPLWAAEEWEHCTKTCGTSGYQLRTVRCLQPLHDGTNRSVHSKYCAGDRPESRRP
CNRVPCPAPWKTGPWNECSVTCGEGKEVRQVLCRAGDHCDGEKPESVRACQLPPCNDEPC
LGDKSIFCQMEVLARYCSIPGYNKLCCESCSKRSSTLPPPYLSEAAETHDDAIFNPSDLP
GSLVMPTSLVPYYSETPAKKKKSLSRISSMAGPNEHAAFRPNSKSNGANLSQRQAQPAEN
KTLGPASPPTKSGHLSSSPQLAAAPFLAASDSIGASSQARTSKKDEKLIDKRRPLRSSMS
ER
Download sequence
Identical sequences W5PUM0
XP_012035515.1.66739 ENSOARP00000014152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]