SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014171 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014171
Domain Number 1 Region: 526-684
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-44
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 2 Region: 659-783
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-33
Family Ypt/Rab-GAP domain of gyp1p 0.0049
Further Details:      
 
Domain Number 3 Region: 115-261
Classification Level Classification E-value
Superfamily PH domain-like 1.85e-26
Family Phosphotyrosine-binding domain (PTB) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014171   Gene: ENSOARG00000013220   Transcript: ENSOART00000014378
Sequence length 1051
Comment pep:known_by_projection chromosome:Oar_v3.1:12:53581225:54228323:1 gene:ENSOARG00000013220 transcript:ENSOART00000014378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVRASLRKVSGSSDSVTTLNSEEFVLVPQHGGDTSTKDDEKPELKIVSNGDEQLEKAME
EILRDSEKGQSSLPVDCPSSSEISDHSFGNISARQTNKPSLQLILDPSNTEISTPRPSSP
SEIPEEDSVLFNKLTYLGCMKVSSPRNEVEALRAMATMKSSSQHPFPVTLYVPNVPEGSV
RIIDQSNNVEIASFPIYKVLFCARGHDGTTESSCFAFTESSHGSEEFQIHVFSCEIREAV
SRILYSFCTAFKRSSRQVSDVKDSVIPTPDSDVFTFSVSLEVKEDDGKGNFSPVPKDRDK
FYFKLKQGIEKKVVITVQQLSNKELAIERCFGMLLSPGRNVKNSDMHLLDMESMGKSCDG
RAYVITGMWNPNAPIFLALNEETPKDKRVYMTVAVDMVVTEVVEPVRFLLETVVRVYPAN
ERFWYFSRKTFTETFFMRLKQSEGKGHTNAGDAIYEVVSLQRESEKEDPVTPTSGGGPLS
PQEDEAEEESDNELSSGTGDVSKDCPEKILYSWGELLGRWHSNLGARPKGLSTLVKSGVP
EALRAEVWQLLAGCHDNQAMLDRYRLLITKDSAQESVITRDIHRTFPAHDYFKDTGGDGQ
ESLYKICKAYSVYDEDIGYCQGQSFLAAVLLLHMPEEQAFCVLVKIMYDYGLRDLYKNNF
EDLHCKFYQLERLMQEQLPDLHNHFSDLNLEAHMYASQWFLTLFTAKFPLCMVFHIIDLL
LSEGLNIIFHVALALLKTSKEDLLQADFEGALKFFRVQLPKRYRAEENARRLMEQACNIK
VPTKKLKKYEKEYQTMRESQLQQEDPMDRYKRENRRLQEASMRLEQENDDLAHELVTSKI
ALRNDLDQAEDKADVLNKELLLTKQRLVETEEEKRKQEEETAQLKEVFRKQLEKAEYEIK
KTTAIIAEYKQICSQLSTRLEKQQAASKEELEVVKGKMMACKHCSDIFSKEGALKVAAIS
REDQGIESDDEKDSLKKQLREMELELAQTKLQLVEAKCKIQELEHQRGALMNEIQAAKNS
WFSKTLNSIKTATGTQPLQPPQATQPPKEST
Download sequence
Identical sequences W5PUN9
XP_012042961.1.66739 ENSOARP00000014171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]