SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014180 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014180
Domain Number 1 Region: 186-235
Classification Level Classification E-value
Superfamily UBA-like 0.000000122
Family CUE domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014180   Gene: ENSOARG00000013235   Transcript: ENSOART00000014387
Sequence length 416
Comment pep:known_by_projection chromosome:Oar_v3.1:2:68721493:68744001:1 gene:ENSOARG00000013235 transcript:ENSOART00000014387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNYIHTRQEGSSGGGSKLRLLFSPPSSQDSGLVSLSSSSPVGNESTKAVLECESASEPSN
FAVAPIIEEDEDEERLFLPSGARGSRGPRPLRFSDLTEERLGDGSTADNAETFSDKDTDQ
RSSPDVAKSKGCFTPESPEIVSVDEAGFAVQKNGASSESQPDSPKYPGEQSHLLIEGPSG
TVSLPFSLKANRPPLEVLKKIFPHQKPAVLELILKGCGGDLVSAVEVLLSSRSSSSAADR
TSAGEPEGLVLPSNGHLFEHTLSSYPLSSSKWSVGSAFRVPDTLRFSADSTNMVPNPLAV
PLQHPFPQPPRYPLMLRNTLARNQSSPFLPNDVTLWNTMTLQQQYQLRSQYVSPFPANST
SVFRSSPVLPARTPEDPRIAIPDDGCPMVSKQSIYTEDDYDERSDSSDSRILNSSS
Download sequence
Identical sequences W5PUP8
ENSOARP00000014180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]