SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014269 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014269
Domain Number 1 Region: 2196-2442
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000000246
Family Galacturonase 0.039
Further Details:      
 
Domain Number 2 Region: 2950-2996,3024-3204
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000155
Family Galacturonase 0.028
Further Details:      
 
Domain Number 3 Region: 1015-1102
Classification Level Classification E-value
Superfamily E set domains 0.000000000687
Family E-set domains of sugar-utilizing enzymes 0.021
Further Details:      
 
Domain Number 4 Region: 258-315
Classification Level Classification E-value
Superfamily E set domains 0.0000000101
Family E-set domains of sugar-utilizing enzymes 0.045
Further Details:      
 
Domain Number 5 Region: 928-1000
Classification Level Classification E-value
Superfamily E set domains 0.0000000108
Family E-set domains of sugar-utilizing enzymes 0.041
Further Details:      
 
Domain Number 6 Region: 1196-1254
Classification Level Classification E-value
Superfamily E set domains 0.0000000535
Family E-set domains of sugar-utilizing enzymes 0.028
Further Details:      
 
Domain Number 7 Region: 343-404,439-455
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.000000392
Family Anthrax protective antigen 0.014
Further Details:      
 
Domain Number 8 Region: 1387-1473
Classification Level Classification E-value
Superfamily E set domains 0.00000042
Family E-set domains of sugar-utilizing enzymes 0.023
Further Details:      
 
Domain Number 9 Region: 1570-1640
Classification Level Classification E-value
Superfamily E set domains 0.00000109
Family E-set domains of sugar-utilizing enzymes 0.05
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000014269
Domain Number - Region: 1483-1564
Classification Level Classification E-value
Superfamily E set domains 0.00163
Family Other IPT/TIG domains 0.051
Further Details:      
 
Domain Number - Region: 1736-1791
Classification Level Classification E-value
Superfamily E set domains 0.00308
Family E-set domains of sugar-utilizing enzymes 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014269   Gene: ENSOARG00000013288   Transcript: ENSOART00000014476
Sequence length 4079
Comment pep:known_by_projection chromosome:Oar_v3.1:20:23851546:24291885:-1 gene:ENSOARG00000013288 transcript:ENSOART00000014476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGSLIYLTSIKILLLAVPCLNIHIEPEEGSLAGGTWITVIFDGLELGLLHPANGSQLEI
HLVNVALPTLPSIPCDVSPVFLDVPAVMCRTRSLLPEAQEGVYSLEVQAGGQVVGSPHPG
PQDSCTFKFSRAQTPIVYQVNPASGVPGKLIHVYGWIITGRSETFDFDAEYIDSPLILEA
QGDKWITPCSLVNRQTGSRYPIQEDHGLGTLQCRVEGNYIGSQNVSFSVFNKGKSVIHKD
AWLVSAKQDLFLYQTYSEILSVFPETGSLGGRTDITITGDFFDNPAQVTIAGIPCDIRHV
SPRRIECTTRAPSKGARLSAPQAGNRGLLFEVGDASEDLDLTEATPGYSWQIAPNASSPS
GFWSKEGQPFRARLSGFFVAPETNNYTFWIQADNQASLYFSWSEDLRTKVKMASIRVGTA
DWFDSWEQNGSDKTQQQKTPKLELRGGARYYLEAEHRGTAPSSGVRIGVQIHNTWLNPDV
VSTYLREKHQIRAWAQRLPEIQMLTVSGTGNFFLTWDNVSSQPIPANATAHQIQTAVEEL
LAVKCKLEPLAANILLWQGFEQGLEGSTSDGHLTSGTEPFCGRFSLHQPRHLVLTPPAAQ
KVYRLDQYTHLCLAYRGHENTTLKMTVSFTVGLQNPVKNLTCDWSLLGTSPRCWQFTCTD
LWKTCVRHSSHLQLPPANSPVLVHQIDLLPLSPEMGMFFVDEIIIADTNLTVSQADTGTA
RPGGNLLESLSVVGSPPVYNVTSWLAGCGLELPLITASAVPTEGAEEGSGLVQVTTRRLQ
RTSPPLGGHFRIQLSNTAIPGVPVHISASHLQKLLQTSADDFTSRYLNVSDFTVTEDLKS
CYEHVWTFSWSSQVGDLPNFIKVSNENLTGVNPAVITRVVYDGGIFLGPIFGDMLVTANR
YTQVAVRVNDIPAYCSGSCAFQYLEGSTPQVYSVWYALANAVGLLVYITGTSFSGDYKAL
QVTVNKTSCKVIFSNQTNVVCQTSLLPVGVHQILMLVRPSGLAINASGGGLFLNVEPRLD
AVEPSRAADIGGLWATVRGSGLDNVNLVLFGSQSCVINVTTSSSQRIQCKVPSKGEDGPT
VNVTVILGGRSVVLAMAFTYVSSLNPVIVSLSRNGSGIAGGEIISIGMVLPVNHTDLDAE
VRIGDTRAWVQAQTAQGLEVVLPPLPAGLHGISVSINGVHIHAQGVDLHIQYITEVFSIQ
PRCGSLVGGTILSISGRGFSRDRALLWVLVGSRSCDIVNSTETSVWCETPPPAPLPPPPL
PLSAPVPVEVWAGSKPFPHRPSPRLVGKGFTFMYEVAATPVVTVMRGEVANQSLRLYVEG
QNLSDSVVLLGNLSCDLQTPSPGSNLSLAGCTFSLDTLEAGLYPLQIHQRQMGFADMSAV
PRQWVVMPQITAVFPTRGSTCGGTVLTVRGLAFRSSRGSVEVDLSGPFTCVILSFGDQTV
LCRITPVGDPLPGASFTLNVTVLVNGLPSMCQGNCTLFLCEETTPIMDDWTTNISGSLTT
VLVRGQRLGITADEPVVFVDDRLACTVTFHNASHVACWISDLSPGPHYLSVLHARYGYAC
SSNFSRHFHVWPQVFHYFPKNVSLHGGSLLTLEGTALKGLNSTLVYIGQQACLTVSLGSE
LIQCAVPAGNGSAALDIEVDGASYQMGVIGYSSAFTPELLSVSQSDDVLTFSVARISGAA
NIDIFIGMSPCVGVSGNHTLLHCVVPSLPTGEYQVRGYDRMRGWASSVLVFTSRVTITAV
TENFGRLGGRLVHVFGTGFSPGNISAAVCGAPCQVLANATVSAFSCLVLPLDVSLASLCD
LRPEEEDCETSSCSYIHCDLTITVGTESLPESWPYFYICEESSRCLLARDHWTESTLPSF
SGLFISPKVERDEVLIYNSSCTITMETEAKMECETPNQPITAKITEIRKSRGQNTQGNFI
FQFCGRWSRAHSWFPKRPPQEGDNVTVEKGQLLLLDTNTSILNFLHVKGGKLIFLDLGPL
ELRTHSILVSDGGELRIGSEDKPFQGKARIKLYGSSYSARFFPYGVKFLAVRNGTLSLHG
SLPEVVVTHLRATANAHDTVLALEDAVDWHAGDEVLVISGMRAEGAKPKEEIVTVETAHS
TDLQLRSPLRYSHNSTENWVAGEHHVLKVMLVLLSRSITIQGNLTDERVQFLASCQGASA
SEGDLQNCLYSKSEKMLGSRDLGARVIVQSFPEEPSQVQLKGVQFRDLGQAFHEHVSSLM
LIGAMRGSYLQGCTVWQSFSRGLSMSQTSSLKVDSNVFYDISGHALLVGTSPKIRYIPWE
VIPGGEKGWSEQGNIIRNNVIIRVSGAEGLSSPEVVTPSGIYIRHPTNVIEGNRVFAAGY
GYFFHLVTNKTSQAPLLSFTRNSAHSCTRSGLFVYPKFQPPWDNSTGSTLFQNFTVWGSA
GGAQIFRSSNLHLKNFQVYACRDFGIDVLESDANTSITDSLLLGHFAHRGNLCMSAGIKS
PRRWELRVSNTTFVNFDLTHCVAIRTCSGCSQGQGGFTVKTNQLKFVNSPNLVAFPSPHA
AILEDLDGSLSGKNRSHILASMETLPASCVVKASFSQLVHGSVCEENVLFHRMSIGLANA
LNISHDLTITDSRNKTTTVSYVHDTLSNPYGWMALLLDQETYSLRFKNPWASSALQYSAT
FDNFAPGNYLLLVHTDVWVYPDILIRCGSHVGRSLSSLPSPGRDQGCDWFFDSQLRQLTY
LVSGEGQVKVVLQVRKGVGPTISASTSVPKSVLKWSLPETWEGVAEGWGGHSGASPGPGE
DVLILSNRTVLVDTDLPPLRGLYVMGTLEFPVDRSNILSVACMLIAGGELRVGTSENPLE
KEKKLLIHLRASEGVFCDRFNGIHIDPGTVGVFGKVQLHSAYPKKSWTRLGADIASGNER
IIVEDTVDWRPHDKIVLSSSSYEPHEAEVLTVKEVRGHHIRIHERLRHRHIGSAHFMEGG
RHIRLAAEVGLLTRNIQIQGDTPCRGRLLVGSFRKSSVEEFSGILQLFNVEIQNFGSPLH
SSIELTNVSAGSWIISSSLHQSCGGGIHAAASQGVILNDNVVFSTAGHGIDLEGQDYSLS
KNLVVLMTQSAWSPVWVAGIKVNKAKNTHLHGNVVAGSERLGFHIQGHRCSSPESLWSDN
VAHSSLHGLHLYKGSGLVNCTGISGFLAFKNFDYGAMLQVENSMEIENLTLVDNTVGLFT
AVYVSSAPRCYIRNLQIVLRNSVIVATSSSFDCIQDRVKPHSANLTSPDRAPSNPKGGRV
GMLWPVFTSEPNRWPQEPWHKVRNGHLISGIMKLQDVTFSSFVKSCYSDDLDVCILPNAE
NTGIVPPIMAERTSMLKIKDKNKFYFPPLQTRKDLETLVCSESDCESPGKYLFKDLDGRA
LGLPPPVSVFPKTEAEWTGSFFNTGIFREEQKCTYRPLINGYICKQTDQVILILDSADTT
WAMQKLYPVVSVTSGFVDTFSSINASAPCSISRSVSAFYSIVPTRKITKVCFVDQTPRVL
HFFLLGNKNTSKLLLAVFYHELQSPYVFLGDRFIPPTQVHSASSLLNESIGANYFSITDN
LLYVVLQGEEPIEIQSSVSIHLALNVMFSVLEKGWEIMILERLTVFLQISQDQIRFIHQM
PGNEATLKAMADSRAKRKRNCPTVTCTSHDRVGQRRPLMVEMSSYRDLPPTTMETISKVM
VIEIGDLPTVRNAGLIPSLSSNKLQNLAHQVIIAQQTGLLESVLNMTIGALLVTQSKGVI
GYGNTSSFKTGNLIYIRPYSLSVLVQPSDGEVGKELTIQPQLVFLDKQNRRVESLGPPSE
PWVISVSLEGTLDSVLRGCTHAGTQDGYVSFSNLAVLISGSNWHFIFTVISPPAGVNFTA
RSRSFAVLPVTPSERPTIIMAASLCSGVSWLALCCLVCCWFKKSKTRKIKNEEISETQTN
DQRNHSHVSPKHQGSQVETEKEVTRMAEDLRMKVMLAKLNQLPHQSLNGVSRRKVSHRVV
REEGGSREEATVPAPSIASVTSHRNTCTPGSPAQQECLQESRGWKGAQEQVLRYQLAGQD
QLLLLCPDLRRERQRLQGQSQLGKGHISLELSQEKPGSCGATEAFCLHSVHPEAVQEQL
Download sequence
Identical sequences W5PUY7
ENSOARP00000014269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]