SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014490 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014490
Domain Number 1 Region: 220-443
Classification Level Classification E-value
Superfamily RNI-like 2.35e-27
Family Cyclin A/CDK2-associated p19, Skp2 0.0000000173
Further Details:      
 
Domain Number 2 Region: 142-208
Classification Level Classification E-value
Superfamily F-box domain 0.000000000000017
Family F-box domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014490   Gene: ENSOARG00000013520   Transcript: ENSOART00000014703
Sequence length 479
Comment pep:novel chromosome:Oar_v3.1:9:34147092:34150922:-1 gene:ENSOARG00000013520 transcript:ENSOART00000014703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRRPWANVQRRRALDHWPNPATSQFHCVPKRESGRRAPLQLMHAFKTPKPADAIRRKHLQ
EISDQSSNLTTNFTWGWGSSKTSEMLSGMGVSALEKEEVDSENISQELCSNLSHPQSPPR
KRLKSKVNDKDFVIVCRPKLNRENFPSVSWDFLPDELLLGIFSCLCLLELMKVSSVCKRW
YKLVFDEFLWQTVDLMGRNLYPDVVGWLLSQGVVAFHCRLCLPQSFMDQPLAEHFSPFRL
QHPDLSNSVINVSTLHDLLSHCSKLQNLLEGLQLSDPVVNNLAQNTNLLRRNLSGYSGFS
ESSLKTLLSSCSRLDELNLSWCYDFTEKHVQVAVAHVSETITQLNLSRYCRNLQRSDVST
LVGRCPNLFHLDLSDSVMLNNDCFPEFYQLKYLQHLSFIWCYDIIPETLLELGEIPTLET
FQVFGIMPDGTLYLLKEALPHLQINCSHFITIARPTIGNKKNQEIWGIKCWKVCRKPNC
Download sequence
Identical sequences W5PVK7
ENSOARP00000014490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]