SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014560 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014560
Domain Number 1 Region: 341-418
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000162
Family Cyclin A/CDK2-associated p19, Skp2 0.088
Further Details:      
 
Domain Number 2 Region: 95-176
Classification Level Classification E-value
Superfamily F-box domain 0.00000000183
Family F-box domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014560   Gene: ENSOARG00000013583   Transcript: ENSOART00000014774
Sequence length 419
Comment pep:known_by_projection chromosome:Oar_v3.1:24:543944:546358:-1 gene:ENSOARG00000013583 transcript:ENSOART00000014774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPGVDGDPKPPCLPRNGLVKLPGQPNGLGAASITKGSQAAKNRPCQPPPPTLPPPSLA
APPPRAALAGGLCPQAGLPXWAPSRAQPLATDEKILNGLFWYFSACEKCVLAQVCKAWRR
VLYQPKFWAGLTPVLHAKELYTVLPGGEKEFVNLQGFAARGFEGFCLVGVSDLDICEFID
NYALSKKGVKAMSLKRSTITDAGLEVRTATGPEEQGWGARPGSSHSAHPKQTNVRPCRPS
RLPWGGRMLEEVGEAGAKVRGAAVEVALPQEGGSNHRIINTKGSEHLLGPGPRLPDPLCP
GQARLLDLKVAQLRASRAKKEEGARAEGWGQVGNPFCCDHRCVRITDTGLSYLSTMSSLR
SLYLRWCCQVQDFGLKHLLAMRSLRLLSLAGCPLLTATGLSGLVQLQDLEELELTNCPG
Download sequence
Identical sequences W5PVS7
ENSOARP00000014560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]