SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014666 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014666
Domain Number 1 Region: 80-356,463-499
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.72e-51
Family FAD-linked reductases, N-terminal domain 0.00075
Further Details:      
 
Domain Number 2 Region: 337-443
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.49e-23
Family L-aminoacid/polyamine oxidase 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014666   Gene: ENSOARG00000013677   Transcript: ENSOART00000014881
Sequence length 501
Comment pep:known_by_projection chromosome:Oar_v3.1:14:55264896:55273197:-1 gene:ENSOARG00000013677 transcript:ENSOART00000014881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRDNDVRPRLTRKAMGAERARQSQPYTWRLLALVPVFLSLAASLDWQTAHIYDPFEKCMH
DPDYERLLKVVTLGLNRTLKPRRVVVVGAGVAGLVAAKVLSDAGHKVTILEADNRIGGRI
LTYRDRKTGWIGELGAMQVRLGLATRILHELCKSLGLNLTKFTQYDENTWIEVSEVKLRN
YVVEKMPEKLGYKLSPKEKGRSPEEIYQMALNRAIKDLRTLGCKKAMMKFERHTLLEYLL
GEGNLSQPAVRLLGDVMSKDGFFYLSFAEALRAHSCLSDRLRYRRIAGGRGSSRRTRNLK
SMTADVVLLTVSGPALQRIAFTPPLTRRRQEAVRALHYVPATKVFLSFRRPFWHDEHIEG
GHPRTDRTSRVIFYPAPGDGALLLASYTWSDATAPFAGRSLTESLRLALDDVAALHGPIA
YRLWDGTGIVKRWGEDPHSQGGFVVQPPMLFKTDKDEGREYDWSVPYGRIYFAGEHTAYP
HGWVETAVKSALRAAVLINSR
Download sequence
Identical sequences W5PW33
ENSOARP00000014666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]