SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014786 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014786
Domain Number 1 Region: 222-469
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.13e-88
Family Eukaryotic proteases 0.0000757
Further Details:      
 
Domain Number 2 Region: 525-771
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.38e-84
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 3 Region: 879-1092
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.06e-73
Family Eukaryotic proteases 0.00031
Further Details:      
 
Domain Number 4 Region: 186-225
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000103
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 64-127
Classification Level Classification E-value
Superfamily SEA domain 0.00000942
Family SEA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014786   Gene: ENSOARG00000013786   Transcript: ENSOART00000015006
Sequence length 1093
Comment pep:known_by_projection chromosome:Oar_v3.1:5:18726253:18757169:-1 gene:ENSOARG00000013786 transcript:ENSOART00000015006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTASDLRLGPGAPQENLASDEVCRTALSTLVATSIILVTLGVLVASLSTQGVEVEHTA
ELRGIRFAPSLQQETSEYYRTLTPALEMLFVSSFQETELESSCVGCTVLSYWEGNASVLV
RFRLHFLLLALWTPSPGLEEQLLQRGLHARLQGPGIPLASYGTIVSAQLTGSQKGPLTER
DLKSGRCPGNAFSCGNSQCVTKMNPECDDTADCSDGSDEAHCDCGLQPGWKTAGRIVGGV
EASPGEFPWQVSLRENNEHFCGAAIISARWLVSAAHCFNEFQDSPEWVAYVGTTYLSGSE
ASTVRAHVARIITHPSYNSDTADFDVAVLELGRALPFSRHVQPVCLPAASHVFPPRKKCL
ISGWGYLKEDFLVKPEMLQKATVELLDQALCASLYGHSLTDRMVCAGYLDGKVDSCQGDS
GGPLVCEESSGRFFLAGIVSWGIGCAEAQRPGVYARVTSLRDWILETIATASKPPAPTVA
LASTTLSTAWPTSPKSLVTDTLIKPTLAPSTVPLDLATASKPQGCGARPAREKPTRIVGG
LGASLGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVELVRAQLGTASLSGVG
GSPVKVGLRRVVLHPQYNPSILDFDVAVLELARPLVFNKYVQPVCLPLAIQKFPVGRKCL
ISGWGNTQEGNATKPDLLQRASVGIIDHKACSALYNFSLTDRMICAGFLEGKVDSCQGDS
GGPLACEETPGVFYLAGIVSWGIGCAQVKKPGVYTRITRLKGWILATMSSHSLPTAPLPT
TRMPTSSHTRTTAGLTVPGVTASTPTPPATIRVTSQPANRTTAAATSTPRGQTPLPPTLK
TTVGAQLPGHAGVSPEPSRPRHSQAGLHGGTGQLAWRRRGPPREHRCGAVLVAERWLLSA
AHCFDVYGDPKQWAAFLGTPFLSGADGQLERVARIHKHPFYNLYTLDYDVALLELVGPVR
RSRLVRPICLPEPAPRPPDGARCVITGWGSVREGGSMARQLQKAAVRLLSEQTCRRFYPV
QISSRMLCAGFPQGGVDSCSGDAGGPLACREPSGRWVLTGVTSWGYGCGRPQFPGVYTRV
AAVRGWIGQNIQE
Download sequence
Identical sequences W5PWF3
ENSOARP00000014786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]