SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014794 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014794
Domain Number 1 Region: 350-770
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.7e-97
Family Phosphofructokinase 0.00000716
Further Details:      
 
Domain Number 2 Region: 24-351
Classification Level Classification E-value
Superfamily Phosphofructokinase 6.28e-86
Family Phosphofructokinase 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014794   Gene: ENSOARG00000013790   Transcript: ENSOART00000015014
Sequence length 790
Comment pep:known_by_projection chromosome:Oar_v3.1:13:44269126:44319040:-1 gene:ENSOARG00000013790 transcript:ENSOART00000015014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPCPRSSPQSGARRPKFRARLAGAGKAIGVRTSGGDAQGMNAAVRAVVRMGIYVGAKVYF
IYEGYQGMVDGGSNIVEANWESVSSILQVLVSIIGFKQCECFLTNSPLRWQTCSGLHQLI
PQVFVAGGAADLKAAIHWCKTWSSITSKVCRTGKISAEQVQKHGHLNVVGMVGSIDNDFC
GTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFL
PESPPEEGWQENMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEQIKELVVTQLGYD
TRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATPETPACVVSLSGNQAVRLPLME
CVQMTQEVQKAMDERRFKDAVQLRGRSFENNLNTYKRLAIKLPDSEIPKVGDPAPILSPA
SGAAGMNAAVRAAVRVGISEGHKMFAVYDGFEGFAKGQIKEIGWGDVGGWTGQGGSILGT
KRILPGKYLEDIAAQMRTHGISALLIIGGFEAYLGLLELLAARQKHEEFCVPMVMVPATV
SNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGFCGYLANMGGLAAG
ADAAYIFEEPFIRDLQSNVEHLTEKMKTSIQRGLVLRNESCSENYTTDFIYQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWISSKLRESAGKGKKFLSEDSVCVL
GISKRTLLFQPVAELKKETDFEHRIPKEQWWLKLRPLMKILAKYKVSFEVSDASQLEPVQ
PHGAEEPAAI
Download sequence
Identical sequences W5PWG1
ENSOARP00000014794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]