SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014798 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014798
Domain Number 1 Region: 116-184
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.79e-29
Family Skp1 dimerisation domain-like 0.0000133
Further Details:      
 
Domain Number 2 Region: 3-36,72-101
Classification Level Classification E-value
Superfamily POZ domain 2.04e-20
Family BTB/POZ domain 0.0000737
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014798   Gene: ENSOARG00000013802   Transcript: ENSOART00000015018
Sequence length 186
Comment pep:novel chromosome:Oar_v3.1:5:43178830:43186709:-1 gene:ENSOARG00000013802 transcript:ENSOART00000015018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEEHEHYIKKPRKQILEHFKTSAVNMDLLL
ISVDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWD
QEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEE
EAQVGS
Download sequence
Identical sequences W5PWG5
ENSOARP00000014798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]