SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014949 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014949
Domain Number 1 Region: 30-148
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 2.53e-42
Family Interleukin 17F, IL-17F 0.0000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014949   Gene: ENSOARG00000013930   Transcript: ENSOART00000015169
Sequence length 153
Comment pep:novel chromosome:Oar_v3.1:20:24394173:24399987:1 gene:ENSOARG00000013930 transcript:ENSOART00000015169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASMRTASMSLLLLLSLVALVKAGVIIPQSPGCPPTEDKNFPQHVRVNLNIVNRNTNSRR
PTDYHKRSTSPWTLHRNEDPERYPSVIWEAKCSHSGCINAEGKVDHHMNSVTIQQEILVL
RRESQHCPHSFRLEKMLVAVGCTCVTPIVRHVA
Download sequence
Identical sequences W5PWW6
ENSOARP00000014949 XP_004018936.1.66739 XP_012007165.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]