SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014950 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014950
Domain Number 1 Region: 254-581
Classification Level Classification E-value
Superfamily RNI-like 2.22e-26
Family Rna1p (RanGAP1), N-terminal domain 0.035
Further Details:      
 
Domain Number 2 Region: 181-235
Classification Level Classification E-value
Superfamily F-box domain 0.00000000824
Family F-box domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014950   Gene: ENSOARG00000013926   Transcript: ENSOART00000015170
Sequence length 606
Comment pep:known_by_projection chromosome:Oar_v3.1:9:13540439:13544787:1 gene:ENSOARG00000013926 transcript:ENSOART00000015170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RHNRPAPARRPGPGRPRSAPAPPLWSPAATGGPAGQCPPRSAPAPPGWGPARPCPGPAAS
TRSPPGDPGSPEPQAHRGRRGDSNLQGKKGGSCVRGRTPSAARTRSAEDWWWDRLAPSGS
GYHLLQSDSMLLVLPGPRPARPRAHRRAARRAQRLRSPGSRAAEAKPRTAPAPTALQEPD
PGWGYRVPLEILLQIFGLLVAADGPIPFLGRAARVCRLWNEAASQPALWHTLTLSPPLAG
RPAKSGAKAEKKLLSSLEWLMPNRFSQLQRLTLIHWKSQVHPVLKLVSESCPRLTFLKLS
DCHGVTPDALIMLAKACPQLHSLDIQHSMVESTAVVSFLEEAGPRMQKLWLTYNSQTTAI
LGALLGSCCPQLQVLEVSTGLNHNITPLQLPVEALQKGCPQLQVLRLLNLMWLPKPSGRA
MTPGPGFPSLEELCLASSTCNFVSNEVLGRLLHGSPHLRLLDLRGCARITPAGLHDLPCQ
ELEQLHLGLYGMSDRLTLAKEGSPLLTQKWCHSLRELDLSGQGFSEKDLEQALAAFSGTP
GGSHLALCSLNLRGTRVTPGTVSSVISSCPGLQYLNLESCRCLPRGRGPEVQWCRDQLLT
SLPSPS
Download sequence
Identical sequences W5PWW7
ENSOARP00000014950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]