SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000014961 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000014961
Domain Number 1 Region: 553-712
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.07e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0089
Further Details:      
 
Domain Number 2 Region: 687-810
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0051
Further Details:      
 
Domain Number 3 Region: 125-272
Classification Level Classification E-value
Superfamily PH domain-like 7.26e-26
Family Phosphotyrosine-binding domain (PTB) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000014961
Domain Number - Region: 998-1032
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0602
Family Trimerization domain of TRAF 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000014961   Gene: ENSOARG00000013938   Transcript: ENSOART00000015181
Sequence length 1069
Comment pep:known_by_projection chromosome:Oar_v3.1:3:12577964:12713899:-1 gene:ENSOARG00000013938 transcript:ENSOART00000015181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDKASVGKISVSSDSVSTLNSEDFVLVSRQGDETPSTNNGSDDEKTGLKIIGNGSEQQL
QKELADVLMDPPMDDQPGDKELVEGSQLDGEGDGPLSNQLSASSTINPVSLVGLQKPEMS
LPVKPGQGDSEGSSPFTPVADEDSVVFSKLTYLGCASVNAPRSEVEALRMMSILRGQCQI
SLDVTLSVPNVSEGTVRLLDPQTNTEIANYPIYKILFCVRGHDGTPESDCFAFTESHYNA
ELFRIHVFRCEIQEAVSRILYSFATAFRRSAKQTPLSATAAPQTPDSDIFTFSVSLEIKE
DDGKGYFSAVPKDKDRQCFKLRQGIDKKIVIYVQQTTNKELAIERCFGLLLSPGKDVRNS
DMHLLDLESMGKSSDGKSYVITGSWNPKSPHFQVVNEETPKDKVLFMTTAVDLVITEVQE
PVRFLLETKVRVCSPNERLFWPFSKRSTTENFFLKLKQIKQKERKNNTDTLYEVVCLESE
SERERRKTTASPSIRLPQSGSQSSMIPSPPEDDEEEDNDEPLLSGSGDVSKECAEKILET
WGELLSKWHLNLSVRPKQLSSLVRSGVPEALRGEVWQLLAGCHNNDHLVEKYRILITKES
PQDSAITRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLL
HMPEEQAFSVLVKIMFDYGLRELFKQNFEDLHCKFYQLERLMQEYIPDLYNHFLDISLEA
HMYASQWFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALGLLKTSKDDLLLTDFEGAL
KFFRVQLPKRYRSEENAKKLMELACNMKISQKKLKKYEKEYHTMREQQAQQEDPIERFER
ENRRLQEANMRLEQENDDLAHELVTSKIALRKDLDNAEEKADALNKELLMTKQKLIDAEE
EKRRLEEESAQLKEMCRRELDKAESEIKKNSSIIGDYKQICSQLSERLEKQQAANKVEIE
KIRQKVDDCERCREFFNKEGRIKGMGSAKEVVDEDTDEEKETLKNQLREMELELAQTKLQ
LVEAECKIQDLEHHLGLALNEVQAAKKTWFNRTLSSIKTATGVQGKETC
Download sequence
Identical sequences W5PWX7
ENSOARP00000014961 XP_012011867.1.54773 XP_012011868.1.54773 XP_012018814.1.66739 XP_014949684.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]