SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015048 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015048
Domain Number 1 Region: 98-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.7e-16
Family Complement control module/SCR domain 0.00027
Further Details:      
 
Domain Number 2 Region: 222-283
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.00058
Further Details:      
 
Domain Number 3 Region: 160-232
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000472
Family Complement control module/SCR domain 0.00082
Further Details:      
 
Domain Number 4 Region: 35-108
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000031
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015048   Gene: ENSOARG00000014022   Transcript: ENSOART00000015268
Sequence length 284
Comment pep:novel chromosome:Oar_v3.1:12:73798668:73841610:-1 gene:ENSOARG00000014022 transcript:ENSOART00000015268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNKPKAHRLSFKISKTHPLLQLPLGLLFSLFLDACGDPPRFETMRLRGAPKPRYRPGERV
QYDCRLGFKPIVPLRSRSAVCEDDNTWSALEEACTRKSCPNLGDPVNGQVYFVNGSVLFG
SQAHFVCNQGFYMIGARILHCEISENNVNWNDDPPVCEKILCSTPGNIKNGRFTIYKDEY
HYNEVVTYTCDPSNGPDEYSLVGESRLTCVDQDRWSSDPPECKVVKCDYPVVEHGMILSG
FRRKFYYKAQVVFQCNQGFSLHGSNTIVCNANSTWEPEIPTCTK
Download sequence
Identical sequences W5PX64
ENSOARP00000015048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]