SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015085 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015085
Domain Number 1 Region: 201-264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000195
Family Complement control module/SCR domain 0.00075
Further Details:      
 
Domain Number 2 Region: 79-151
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000695
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 140-204
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000175
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 4 Region: 15-85
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000229
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000015085
Domain Number - Region: 342-428
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00956
Family ABC transporter ATPase domain-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015085   Gene: ENSOARG00000014055   Transcript: ENSOART00000015305
Sequence length 432
Comment pep:novel chromosome:Oar_v3.1:12:73962475:74003129:-1 gene:ENSOARG00000014055 transcript:ENSOART00000015305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAALVLPLPIFSVRCIDPPVLDSMKLKGVIKHRYYPGDRIDYECYRGYFYVWPYLLSA
TCEPNGSWSRIEEACLRKSCPDPEVKHGKVVAPNDTFEWESEAHISCNEGYFLRGKPIIV
CNLIGENVSWSDTIPHCEKIYCGQPPKIKHGKHTNSYRNIFEYNELITYSCDPSNGPDEY
ALVGQNKLTCIEPNKWSSDPPLCKVVKCERPFLEHGIMVSGSREKFSYQSVVVFECLQGF
YLNGSNLVFCGGNDTWEPEMPTCIKGYKPTHPTKTPLSKYPGYPNPSEEIPSLEDFEDLD
AGIIALAILTAIVAVIVVCTCLYRCLFSEKNEEKDMKEKEKELKEKEERDMKEKEEREKK
EKERKEKEEKERKEKEKEKKEKERKEKEEKEKKEKEEKEKERKEKEKEKKEKEKEMKEKK
EKQQKKEKEMKG
Download sequence
Identical sequences W5PXA1
ENSOARP00000015085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]