SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015184 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015184
Domain Number 1 Region: 1197-1272
Classification Level Classification E-value
Superfamily Immunoglobulin 3.01e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 1286-1378
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000244
Family I set domains 0.0094
Further Details:      
 
Domain Number 3 Region: 888-951
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000755
Family I set domains 0.049
Further Details:      
 
Domain Number 4 Region: 1406-1488
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000027
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 661-728
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000105
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 6 Region: 1539-1607
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000693
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 7 Region: 783-849
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000798
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 8 Region: 432-492
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 9 Region: 32-81
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000693
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 10 Region: 376-437
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 11 Region: 529-583
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000017
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 12 Region: 1669-1725
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000916
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 13 Region: 729-788
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000183
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 14 Region: 296-359
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000249
Family TSP-1 type 1 repeat 0.0059
Further Details:      
 
Domain Number 15 Region: 610-666
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000115
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 
Domain Number 16 Region: 1607-1666
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000275
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000015184
Domain Number - Region: 1486-1545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000746
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015184   Gene: ENSOARG00000014133   Transcript: ENSOART00000015405
Sequence length 1762
Comment pep:known_by_projection chromosome:Oar_v3.1:2:86407235:86900674:1 gene:ENSOARG00000014133 transcript:ENSOART00000015405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECCRRASPGTPFLLLAFLLLSSRTARSEEDRDGLWDAWGPWSECSRTCGGGASYSLRRC
LSSKSCEGRNIRYRTCSNVDCPPEAGDFRAQQCSAHNDVKYHGQFYEWLPVSNDPDNPCS
LKCQAKGTALVVELAPKVLDGTRCYTESLDMCISGLCQIVGCDHQLGSTIKEDNCGVCNG
DGSTCRLVRGQYKSQLTATKLDNTVVGIPYGSRHIRLVLKGPDHLYLETKTLQGAKGENS
LSSTGIFLVDNSSVDFQKFPDKEILRMAGPLTADFIVKIRSSGPENSTVQFIFYQPIIHR
WRETDFFPCSATCGGGYQLTSAECYDLRSNRVVADQYCHYYPENIKPKPKLQECNLDPCP
ASDGYKQIMPYDIYHPLPRWEATPWTACSSSCGGGIQSRAVSCVEEDIQGHVSSAEEWKC
MYTPKMPTVQPCNIFDCPKWLAQEWSPCTVTCGQGLRYRVVLCIDHREVHTGGCSPKTKP
HIKEECIIPTPCYKPKEKLPVEAKLPWYKQAQEFEEGAAVSEEPSFIPEAWSACTVTCGV
GTQVRIVRCQVLLSFSQSVADLPVDECEGPKPASQRPCYAGPCHGETPELNLEETDGLLG
GLQDFDQLYDWEYEGFTKCSESCGGGVQEAVVSCLNKQTREPVDENLCVTSRRPPQLLKS
CSLDPCPARWEIGKWSPCSLTCGVGLQTRDVFCSHLLSREINETVILADELCRQPKPTTV
QACNRFNCPPAWYPAQWQPCSRTCAGGIQKREVLCKQRMADGSFLELPETFCSAPKLASQ
QACKKDDCPSEWLLSDWTECSTSCGEGTQTRSAVCRKVLKTGVSSIVNSSLCPPLPFSSS
IRPCMLAACARPGRPSTKHSPHIAAARKVYIQTRRQRKLHFVVGGFAYLLPKTAVVLRCP
TRRFRKPLITWEKDGQHLISSAHVTVAPFGYLKIHRLKPSDAGIYTCSAGPAREQFVIKL
IGGNRKLVARPLSLRIDEEALAVRKASPKEALQTHKHQNGIFSNGSKAEKRGLPADTGGR
YDDLVSRLLEQGGWPGELLASWELQDSTERNASSEEDQNAEQALLRLPFTMVTEQQRLDD
ILRNLSQQPQELRDVYSKHLVAQLAQEIYRSHLEHQDALLKPSERRGPPVAIPPHKHVSG
FSSFSRILSTGEGGGGSRRPHRKPVIVRKISAAQQLSASEVVTHLGQTVALASGTLSVLL
HCEAIGNPRPTISWAKNGEEVQFSDRILLQPDDSLQILAPVEADVGFYTCNASNALGYDS
VSIAITLAGKPLVKTSREVVINTEEPAITVDVGSTVRTVQGVNVTINCQAAGVPEAEVTW
FRNKSKLGSPPPLHEGSLVLTAVSSLDQGLYSCRAANLHGELTESTELLILEPPHVPTQL
DDIWALLSATGLNLPSVLTSPLGTQLVLDPGNSALLGCPVKGDPTPNITWFHGDQPVANV
TGLMYHILAAGQILQVADLSGGSHGDFSCLAQNEAGMLVQKAFLVIQDYWWSVDRPVTCS
ASCGNRGVQQPRLRCLLNNTEVDPAHCAGKVRPAVQPIPCNRRDCPSRWMVTSWSACTRS
CGGGVQTRRVTCQKLKASGISTPVPSDVCTQLAKRPVDTQACNQQLCVEWAFSSWSQCNG
PCIGPRLSVQHRQVFCQTLDGITLPSEQCSALPRPVSTQNCWSEACNVYWRVSLWTLCTA
TCGNYGFQSRRVECVHARTNKAVPDHLCSWGPRPANWQRCNITPCENTECRDTTRYCEKV
KQLKLCQLNQFKSRCCGTCAKA
Download sequence
Identical sequences W5PXK0
ENSOARP00000015184 XP_004004439.1.66739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]