SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015243 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015243
Domain Number 1 Region: 289-352
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.72e-20
Family Complement control module/SCR domain 0.005
Further Details:      
 
Domain Number 2 Region: 114-168
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0003
Further Details:      
 
Domain Number 3 Region: 225-286
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000446
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 166-229
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000148
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 5 Region: 55-109
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000653
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000015243
Domain Number - Region: 20-52
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0149
Family Complement control module/SCR domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015243   Gene: ENSOARG00000014196   Transcript: ENSOART00000015464
Sequence length 355
Comment pep:novel chromosome:Oar_v3.1:12:74010151:74027129:1 gene:ENSOARG00000014196 transcript:ENSOART00000015464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGYIMHLKDTFQQVLVNTIYRCNRYFVTPSQSPWDYMTCTLKGWSPEVPCLRQCTFNYL
ENGYYTNSQEKYLQGKTVRVRCHDGYSLHNNQNTMTCTEKGWYPPPICVRVGLPCGLPPS
IQNGAVRHKKDSYQYGEKATYTCNEGFRIYGFASIRCLGGKWSRTPKCISTDCFNLPSFD
GVVLTGKKKKSYRSGEQVAFKCQPYYQLDGSNTIQCVKSKWIGRPVCRDVSCVNPPRVKN
AVIQSERPRYQNGERVRYECIGTYDILGDVDVTCLNGTWTKPPQCKEACEISEEMMKKHN
IQLKWTTSNKLYSKTQDHIEFICKHGYHPVTPYRTFRTACQEGKVVYPRCGQNTG
Download sequence
Identical sequences W5PXQ9
ENSOARP00000015243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]