SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015287 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015287
Domain Number 1 Region: 7-71
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000523
Family Fibronectin type I module 0.019
Further Details:      
 
Domain Number 2 Region: 103-147
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000667
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015287   Gene: ENSOARG00000014240   Transcript: ENSOART00000015509
Sequence length 254
Comment pep:known chromosome:Oar_v3.1:8:57077576:57079077:-1 gene:ENSOARG00000014240 transcript:ENSOART00000015509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAKDGAPCVFGGTVYRSGESFQSSCKYQCTCLDGSVGCVPLCSVDIRLPSPDCPFPRRVK
LPGKCCEEWVCDEPKEHTVVGPALAAYRPEDTFGPDPTMIRANCLVQTTEWSACSKTCGM
GISTRVTNDNAFCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTS
MKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKSMMFIKTCACHYNCPGDNDI
FESLYYRKMYGDMA
Download sequence
Identical sequences W5PXV3
ENSOARP00000015287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]