SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015297 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015297
Domain Number 1 Region: 70-315,359-480
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.7e-129
Family Oxysterol-binding protein 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015297   Gene: ENSOARG00000014245   Transcript: ENSOART00000015519
Sequence length 480
Comment pep:known_by_projection chromosome:Oar_v3.1:13:54262245:54278986:-1 gene:ENSOARG00000014245 transcript:ENSOART00000015519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGEEEFFDAVTGFDSDNSSGEFSEANQRLTGVIHVDSSKSNGIGKVGDGPPQENGIQKH
RTSLPAPMFTRSDFSVWSILKKCIGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHRA
SRQPQSLERMQSVAAFAVSAVASQWERTGKPFNPLLGETYELIREDLGFRFISEQVSHHP
PISAFYSEGLHQDFLFHGSIYPKLKFWGKSVEAEPRGTITLELLKHKEAYTWTNPTCCVH
NVIIGKLWIEQYGTVEILNHRTGDKCVLHFKPCGAFGKELHKVEGYIQDKSKKKLFMIYG
KWTECLWGIDPVAYESFRKQERRGDSLRKTKPDDGPEKADGDVADTVPESQETVQVIPGS
KLLWRVNTRPPNSAQMYNFTSFTVSLNELETGMEKILAPTDCRLRPDIRGMENGNMDLAS
QEKERLEEKQREARRERAREEAEWQTRWFHRGSNPYTGTPDWLYAGGYFERDFSGCPDIY
Download sequence
Identical sequences W5PXW3
XP_004014470.1.66739 ENSOARP00000015297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]