SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015355 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015355
Domain Number 1 Region: 173-232
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000834
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 237-298
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000229
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 49-111
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000634
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 4 Region: 110-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000223
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015355   Gene: ENSOARG00000014309   Transcript: ENSOART00000015580
Sequence length 486
Comment pep:known_by_projection chromosome:Oar_v3.1:12:24786160:24922415:-1 gene:ENSOARG00000014309 transcript:ENSOART00000015580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPSNGDGFLEQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGIPENGF
RTPSGGVFFESSVTRFHCQDGFKLKGSTKRLCMKHLNGTLGWIPSDRPVCVQEDCRIPQI
EDAEIHNKTYRHGDKLIITCHEGFKIRYPDLYNVVSLCRDDGTWDNLPICQGCLRPLASS
NGYVNISEFQTSFPVGTVISYHCFPGFKLEGSEYLECLHNLIWSSSPPRCLALEAAQVCP
LPPMVSHGDFICHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQVYCIK
SEQTWPSTHETLLTTWKIVAFTATSVLLALLLVILARMFQTKFKAHFPPRGPPRSSSSDP
DFVVVDGVPVMLPSYDEAVSGGFSALGPGYLASVGQGCPLPVDDQSPPAYPGSGDTDTGP
GESETCDSVSGSSELLQSLYSPPTCQGGTRPASENPDTAPSTAGEVASTSPGIDIADEIP
LMEEDP
Download sequence
Identical sequences W5PY21
ENSOARP00000015355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]