SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015385 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015385
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000235
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number 2 Region: 94-163
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000366
Family Fibronectin type I module 0.049
Further Details:      
 
Domain Number 3 Region: 229-273
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000119
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015385   Gene: ENSOARG00000014336   Transcript: ENSOART00000015610
Sequence length 382
Comment pep:known_by_projection chromosome:Oar_v3.1:1:62004819:62007353:1 gene:ENSOARG00000014336 transcript:ENSOART00000015610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASSSLPSRLALAVTLLHLARLALSTCPAACHCPLEAPKCAPGVGLVQDSCGCCKVCAKQL
NEDCSKTEPCDHTKGLECNFGASSTALKGICRAQSEGRPCEYNSRIYQNGESFQPNCKHQ
CTCIDGAVGCIPLCPQELSLPNLGCPNPRLVKVTGQCCEEWVCDDDSAKDPMDDREGLQG
KELAFDASEVELTRNNELIAVGKSGFLKRLPVFGMEPRILYTPSSHGQKCIVQTTSWSQC
SKTCGTGISTRVTNDNPECRLVKETRICEVRPCGQPVYSSLKKGKKCSKTKKSPEPVHFT
YAGCSSVKKYRPKYCGSCVDGRCCTPQQTRTVKMRFRCEDGEMFSKNVMMIQSCRCSYNC
PHASEAAFPFYRLFNDIHKFRD
Download sequence
Identical sequences W5PY51
ENSOARP00000015385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]