SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015463 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015463
Domain Number 1 Region: 832-893
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.28e-18
Family Complement control module/SCR domain 0.0076
Further Details:      
 
Domain Number 2 Region: 774-832
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000553
Family Complement control module/SCR domain 0.0006
Further Details:      
 
Domain Number 3 Region: 327-384
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000249
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 259-322
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000393
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 5 Region: 388-442
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000836
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 206-270
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000131
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 7 Region: 507-562
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000256
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 8 Region: 85-142
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000405
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 9 Region: 153-210
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000498
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 10 Region: 22-88
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000153
Family Complement control module/SCR domain 0.0037
Further Details:      
 
Domain Number 11 Region: 448-501
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000058
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015463   Gene: ENSOARG00000014405   Transcript: ENSOART00000015689
Sequence length 894
Comment pep:novel chromosome:Oar_v3.1:12:74087298:74114558:1 gene:ENSOARG00000014405 transcript:ENSOART00000015689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLTHVLLILWISTVGGQGRHCDFPKINHGILYNEKKYKASFPVSLGKILYYSCEYNFM
SPSKHFWTPITCTEGGWSPTPKCLRVCFFPFVENGQSASSGQTYLEGATVQITCNKGYSL
PDDKGSITCAEGGWSSPPECISTKKCLKTDIVVANGFFSESEYAYSVNKETQYKCKPGYM
TADGKTSGTVRCLQGGWSSQPTCIKSCDRPVLLNARVKSDVTWFQLNDRLNYECHAGYEN
QDGRTTDSIVCGEDGWSHLPTCREIECHLPFLEANVDVYPKQEKYKVGDVLKFSCRQRLK
RVGPDSVQCYQFGWSPNFPTCKGQVRSCGQPPQLPNGKPKHVKQEKYEHSEMVEYDCSPN
FVMKGPKKIQCMDGEWTTLPTCVEPGKACRFMPQLENGYSQPSVPPYQHGVSVVLSCRNA
YTMIGNTTVTCIDGIWTELPKCVATNQLKRCEKPRFYVRGQLSSYMHEFNHNARVSYKCA
GKSTYVQTVCINGKWDPEPDCLGKKIQLCPPPPQIPNAQNMLTTVNYQEGEKVTVLCKEN
YAFLEAKELVCKSGQWQSLPLCVVSLRCISNSDQRRNGFETFTGNSILFIRIIQYPALRC
RAGNLRTQLQCGGATPHSTSKLVSQKQRQRHKLKKVTYYCLGLADEAVAFCLSRSLRICT
FCDRVGRSLSTMELIPADLNRKRPMLLFGVKKVNTEEYVYKSFQTVTVAPENKNGKGVTY
FYLSSVIKHLYGGERKHYSCIPVIRLHDRNFILYCNTNIFLTLACHLPESAQYCGLPPPI
DNGDITSFPLSAYSPGSVVQYRCQSFYELRGNLTVTCRNGQWSEPPTCIDACIISEDRMN
KNNIQLKWRNPPNRYAKTGDFIEFECKSSHKERTPIQSFRVLCQEGKFEYPTCE
Download sequence
Identical sequences W5PYC9
ENSOARP00000015463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]