SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015514 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015514
Domain Number 1 Region: 79-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.39e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 136-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000042
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 3 Region: 221-281
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000104
Family EGF-type module 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000015514
Domain Number - Region: 270-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000134
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 195-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00126
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015514   Gene: ENSOARG00000014458   Transcript: ENSOART00000015741
Sequence length 439
Comment pep:known_by_projection chromosome:Oar_v3.1:3:106141259:106197636:1 gene:ENSOARG00000014458 transcript:ENSOART00000015741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPKCPRALFLLLLFLACPESRASQNCLNKQQFLMAIRHLQQLLKGQETRFAEGVRHMKS
RLAALQSSVSKAGPDTPPVSCPALNAPLDGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVV
CLPNGTWTGEQPRCKDISECSSQPCQNGGTCVEGVNQYRCICPPGRTGSRCQHQAHTAAP
EGSEAGDAAFSRAPRCAQVERTQHCSCEAGFHLSGAAADSVCQDVNECELYGQEGRPQLC
MHACVNTPGSYRCVCPSGYRTLADGKSCEDVDECVSTQPVCPRGTVCINTGGGFQCVSPE
CPEGSSNVSYVKTSPFQCERNPCPMDSRPCRHMPKTISFHYLSLPSNLKTPITLFRMATA
SAPGRPGPNSLRFGIVGGNSRGHFVMQRSDRQTGELILVQTLEGPQTLEVDVDMSEYLDR
SFQASHVSKVTIFVSPYDF
Download sequence
Identical sequences W5PYI0
ENSOARP00000015514 XP_004006236.1.66739 XP_012012470.1.54773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]