SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015614 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015614
Domain Number 1 Region: 1008-1301
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.28e-61
Family Complement components 0.0000108
Further Details:      
 
Domain Number 2 Region: 1376-1528
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.57e-33
Family Alpha-macroglobulin receptor domain 0.001
Further Details:      
 
Domain Number 3 Region: 1527-1675
Classification Level Classification E-value
Superfamily TIMP-like 2.24e-33
Family Netrin-like domain (NTR/C345C module) 0.0015
Further Details:      
 
Domain Number 4 Region: 685-754
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 3.27e-17
Family Anaphylotoxins (complement system) 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000015614
Domain Number - Region: 832-876
Classification Level Classification E-value
Superfamily E set domains 0.0028
Family SVA-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015614   Gene: ENSOARG00000014548   Transcript: ENSOART00000015845
Sequence length 1677
Comment pep:novel chromosome:Oar_v3.1:5:12291318:12320770:1 gene:ENSOARG00000014548 transcript:ENSOART00000015845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPTAMDVPWALGLLLLLLGIPVAQAEPLYILVTPRVLRIGSPETIHVEAHSDSSEPLSH
PLEVNLSVWDFPRKNTLVARRKLVLSQENHFMDQASVTIPEDLVYPPKPGTQYVIIKATW
SPTSVSSSMEKLVLVAPHAGYIFIQTDKTIYTPEQSVQYRVYTVNHRMDPVPRTFTLDIK
NPEGIAVISKDLLPDNGVYINSFTLPERISIGTWTIEASYQTAPKQKFKTGFEVKEYVLP
SFEVQLTPTKTFFYLRDEVLGVNIQARYIFNKPVDGHALAIFGVKQDSRRIPIQSSLQRV
EIAQGHGHISLQKDALMAAFQGSEEDFIGASIFVNVTVFSSGGEKVQAEICGVKIVRSPY
NIKFIKTPQYFKPGMPFRFRVFVSNPDGSPASKVLVSCRDEKAQTTLSGEATLVINTDAS
LKELTIRVKTEAPIQPEEQASASMTARPYSTQDESGNFLHIEVKTLSTEVGSNLQLSLNT
NLRDSSVNKKITRFTILVLSKGQIVHAKEVKTHGSVLASTIIDVTSKMLPSFRILAFYLL
PKGTGQDPELVADSILIDVNDKCQEKLKIGLKHEAYVQPIQPSSRVALKITGDAEATVGL
VAVDKAVHILNSKHRFTQKKIWDTVEEHDVGCTAGSGKDRLAVFKDAGLDMKMSTGMDTL
ASTDWHCPPSPSPSHRRLRSLKRLETKRKAVNKFKTELEQKCCEAGLRENPVGLSCEERI
PHVRYGPVCIAAFLSCCQLSETLTREAREEQLLLGTTDEDDDLDDLFLEDEPVRSLFPES
WFWKTITLPKTTAGISQYTTDVTVPDSITTWQFVAVSIKTGQGLCVSDPFELTVMKPFFV
DLKLPFSVIRNEQVQIQAVLYNFLQQSIKVRVEFPHKESLCSAAKPDAPSRRIVAVPPFS
SKVVPFVLLPLEIGKVDVEVRARGSMVQDHVRKTLLVQAGGQTEQISQSFLLNPQGCACS
GQTQMQRVPKQEFLNKMPNTEADVFVSVQGDILGETILGTLTPSEAWRLLRIPSGCPEQT
LSSLTPVVILTRYLDTTGQWNKVGVELREKVMKNLARGYSQMLTHRSEDGSYHTSKGNPG
STWLTSYVFRVYALAYRTMTIRALSLDSVCNIANWIITHRQRTRGNFVEESPVVMWSMQS
VLHGCQLFLELSTQELFKVREEKEGKELCSQKIPSLADSMKRAGDFLEKKLPHIRTAFAM
AITSYALALIRSPRANDHLDSFASKDKTHWPVGLDDLDLDDSLYTIEATAYALMQKLELG
RRNETHAIANWLLKKRQLGGGFRSTQTTVVAIEALTRFREAVPFDGVQDLHIQIKSSKKA
LHVEWDIDEKNAYQLRSAKFSAEEELEIRASGTGRGTISILTVYHRSPEFLEDTCKQYHL
NVTLNEAQEGEPGPRDALLLFLNIMTRTLGRRDATMTIMEVSLLTGFYPNQDDLKQLTNE
VERYAFQYETKMNSSDSTVVLYLEKLSHKEDTVLGFRVHRMLKAEFLQAAQVTVYDYYEP
SRRCTSFYNLPTEHASLRKICDKDVCRCAEEQCPSPKDSNHLSQEELQTAACEAGVDFVY
KTSLESVETSDSNPYIYYNMKLQAIIKSGTDSARPLTVKKFVTHTTCRDSLGLQEHETYL
IMGQISDLWRVKSEYIHVLGKETFLMHWPANGTVGKKELLDQLAGFSDYMHTHGCES
Download sequence
Identical sequences W5PYS8
ENSOARP00000015614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]