SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015827 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015827
Domain Number 1 Region: 250-440
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.96e-29
Family Laminin G-like module 0.049
Further Details:      
 
Domain Number 2 Region: 1526-1600
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000639
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 685-830
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000733
Family Matrix metalloproteases, catalytic domain 0.083
Further Details:      
 
Domain Number 4 Region: 538-637,722-773
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000635
Family Zinc protease 0.079
Further Details:      
 
Domain Number 5 Region: 1592-1649
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000709
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Domain Number 6 Region: 1476-1532
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000417
Family Complement control module/SCR domain 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000015827
Domain Number - Region: 843-897,1065-1108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00028
Family Fibronectin type III 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015827   Gene: ENSOARG00000014745   Transcript: ENSOART00000016060
Sequence length 1793
Comment pep:known_by_projection chromosome:Oar_v3.1:12:55756320:56070715:1 gene:ENSOARG00000014745 transcript:ENSOART00000016060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMCFKILRVSLVVLAGWALSTVSSELGWTRKRSLAQRGYLNQVLSEGERCWLGAKVRRPR
VAPQHHLFGVYPSLPGDYLRPYPAGDQGRAHVRCSEPDAGGMVVSSVPPDPTASARKRSE
AEQPAAPWGGDSTIGQSELLGDDDTYLGDGGSKEPLGEAGTPEGTALAATVITSFPCPKE
SGPDTQRKGRTKTRRRRQVVKGQAGGLRGDPEFAPQHFQPWPKHPLTPRDRTGPSEGGIR
NGGGDPSWEAETETVSPQGGLPVLYFSGRREPLLLRPEVLADIPREAFTVEAWVKPEGGQ
NSPAIIAGVFDNCSHTISDKGWALGIRSGKDVGRRDARFFFSLRTDRVKKATTVMGHSRY
QPGKWTHLAATYDGQRMALYVDGTQVASSRDQSGPLNSPFMASCRSLLLGGDSSEDGHSF
RGHLGTLVFWSTARPQSHLQHRPQQPLEVKDLTTLLLTASFEPLEEQWVPFRDGKYPRRE
VLQGFESKPEILSPLQPPLCGQTACDNVELISQYNGHWPLRGEKVIRYRVVNIYDDKGLN
PTVSEEQIRRQHEVLNEAFSRYNISWQLSVHRVHNSTLRHRIVLVNCEPSKIGNDHCDPE
CEHPLTGYDGGDCRLQGRCYSWNRKDGLCHVGCNNMLNDFDEGDCCDPDVTEVRKTCFDP
DSPRRAYMSVKELKEALQLNSTHFLNVYFASSVRENLAGAATWPWDKEAISHLGGVVLNP
AYYGMPGHTNIMIHEVGHVLGLYHVFKGVSERESCDDPCRETVPSMETGDLCADTAPTPK
SKLCQNPEPANDTCGFTYFPGAPFNNYMSYTDDDCTDSFTPNQVARMHCYLDLVYQQWSQ
SQKPTPIPIPPMVIGQTQKSLTIHWLPPISGVMYDRVPGSMCGACTEDGTFRQYVHTASS
QRVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPELHLHHTNMTVPCPAEGCSLELLFQH
PVQADTLTLWVTYLSMGSSPVLFDTEILLEHQKSVHLGPLDTFCDTPLTIKLHVDGKVMG
VKVYTFDERMEIDAALLTSQPHSPLCSGCRPVSYQILREPPFASGLPAAVMHPHRKFTDM
EVMPGQMYRYQVQAAAEAELGEASPPLSHIHGAPYCGDGKVARNLGEECDDGDLLNGDGC
SRACELEEGFNCVGEPSLCYIHEGDGICEPFEKETSIVDCGLYTPKGYLDQWATQAFASH
EDTKKCPVSLVTGAPHSMVCTSYRPDLPEHPPLTGWFPCVPSGNRSQDEGSKQPKGSLKR
EDEVWLKVCFSRPGVATAIFIFLTSDGLVSGKRQRPTVTLYLTDVSGNNHSLGTYELSCQ
HNPLVINITHHSNVLFHHATSVLLNFSTPLVGISAVALRTSSDTSPSAPNSCIIPEQKGQ
NHQGQSCVHRPCGEQGSCVPLLLDHADMVNCTSGGPGLMKCSITCQRGSALQASNGQYLR
PLQKKILLTCSSGHWDGAVSCQPLDCGVPDASLVNYANFSCLEGTNFLKRCSISCIPPAK
LQGLSPWLTCLEDGLWSLPEAYCKLECDAPPVIPNANLLQPRCLQGNHDVGSTCRYECKP
GYYVLGSTENKVRNKSLKIQCLESGIWEQGSCVPVVCEPPSPVFEGMYECTNGFELDSQC
FINCNQESKRLPIRCTKEGRWSEEFKLCENLRGECPPPTSDPKFVEYKCEQGHGIGAVCS
PLCIVLPSDPVILPENITTDTLEHWMEPVRVQSVMCTGRRQWHPDPLLIHCIQSCEPFQG
DGWCDTINNRAYCNYDGGDCCPSTLSSKKVIPFAADCDQDECTCRDPRAEENQ
Download sequence
Identical sequences W5PZE1
XP_004013872.1.66739 XP_012042985.1.66739 ENSOARP00000015827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]