SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015829 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000015829
Domain Number - Region: 39-81
Classification Level Classification E-value
Superfamily F-box domain 0.000763
Family F-box domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015829   Gene: ENSOARG00000014760   Transcript: ENSOART00000016062
Sequence length 128
Comment pep:known chromosome:Oar_v3.1:2:100489026:100504967:-1 gene:ENSOARG00000014760 transcript:ENSOART00000016062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPRRVSPVERFWNKFLQDGALWKNV
IYKTYRHSIFAFTHVLIPVWIIHYYLKYHVTTKPYTIVEKKPRIFPGDTILETGEVIPPM
KEFPDQHH
Download sequence
Identical sequences W5PZE3
XP_020734652.1.74333 ENSOARP00000015829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]