SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015928 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015928
Domain Number 1 Region: 588-860
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.65e-71
Family Eukaryotic proteases 0.000000152
Further Details:      
 
Domain Number 2 Region: 335-443
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-29
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 3 Region: 210-328
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-20
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 4 Region: 84-160
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000222
Family SEA domain 0.011
Further Details:      
 
Domain Number 5 Region: 520-555
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000117
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 448-484
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 484-521
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 8 Region: 560-600
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000108
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015928   Gene: ENSOARG00000014848   Transcript: ENSOART00000016161
Sequence length 861
Comment pep:known_by_projection chromosome:Oar_v3.1:21:35545553:35561823:1 gene:ENSOARG00000014848 transcript:ENSOART00000016161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPAGLAGCRAGGSDGQCAGFSVQNMNGCEEGVEFLPANNSRKVEKGGPRRWVVLVAVLAA
FLALSLLAGLLAWRFQDRNVRVQKIFNGYLSVRNENFLDAYENSNSTEFANLAKKVKEAL
KFLYSGIPVLGPYYKTSTVTAFSEGSVIAYYWSEFDIPKHLVKEAEQAMAEKRMVTVPPR
ARSMSSFVMTSVVAFPSDPRIVQNTRDNSCSFALHAQGSEPTRFSTPGFPDSPYPSHARC
QWTLRGDADSVLSLTFRSFDVATCDERGSDLVTVYDTLSPVEPRAVVQLCGTYPPSYNLT
FLSSQNVLLITLVTSTERRHPGFEAVFFQLPRLSSCGGYLRAAQGTFNSPYYPGHYPPNV
NCTWHIEVPNNKNVKVRFKAFFLQEPNVPVGSCTKDYVEINGEKYCGERPQFVTSSRSNK
ITVHFHSDQSYTDTGFLAEFLSFDARDPCPGSFMCNTGRCIRKELRCDGWADCTDYSDEL
DCKCNATYQFTCKDKFCKPLFWVCDSVRDCEDGSDEEGCSCPPNTFKCDNGKCLPQSQQC
DRKDDCGDGSDEAKCQDVKAVTCTEHTYRCLNGLCVDKSNPRCDGNEDCTDGSDEKDCDC
GRRSFTRQSRVVGGENSDQGEWPWQVSLHALGHGHLCGASLISPSWMVSAAHCFVDDRGF
RYSEHSMWTAFLGLHDQSKRNAPGVQERGLQRIIKHPFFNDFTFDYDIALLQLARPVEYS
ATIRPICLPAADHTFPAGKAIWVTGWGHTQEAGEWGPRVCSQPHCCRIWGLRGCPSVPSF
PTRLPRIVPLPRLSTGGGTPCQGLLFLQGDSGGPLSSPEADGRMFQAGVVSWGEGCAQRN
KPGVYTRLPVFRDWIKAQIGV
Download sequence
Identical sequences W5PZP2
ENSOARP00000015928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]