SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015958 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000015958
Domain Number 1 Region: 258-466
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.39e-54
Family Reprolysin-like 0.00079
Further Details:      
 
Domain Number 2 Region: 559-613
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000196
Family TSP-1 type 1 repeat 0.0007
Further Details:      
 
Domain Number 3 Region: 866-922
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000772
Family TSP-1 type 1 repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015958   Gene: ENSOARG00000014877   Transcript: ENSOART00000016191
Sequence length 922
Comment pep:known_by_projection chromosome:Oar_v3.1:1:127592697:127646617:1 gene:ENSOARG00000014877 transcript:ENSOART00000016191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGWASLMLCALRLPPVAAGPAAAPAQDKAGQPRAAAVAAAAQPRGWRGEEAQEPAEPP
GHPHPLAPQRGSRGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDDSVGAAGLVPAGG
GPNATRRHRGHCFYRGTVDGSSRSLAVFDLCGGLDGFFAVKRARYTWQPLLRGPWAEAED
DARVYGDGSPRILHVYTREGFSFEALPPRTSCETHASPPGARERPPAPRRQDGRWALAPQ
QLPGQSAPCRRRLHLPGPRQVELLLVADASMARMYGRGLQHYLLTLASIANKLYSHASIE
NHIRLVVVKVVVLGDKDKSLEVSKNAATTLKNFCKWQHQHNQLGDDHEEHYDAAILFTRE
DLCGHHSCDTLGMADVGTICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSHDDSKFCEE
NFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQIPGPEELPG
QTYDASQQCNLTFGPEYSVCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGTPCGKGRIC
LQGKCVDKTKKKYYSTSSHGNWGSWGSWGQCSRSCGGGVQFAYRHCNNPAPRNHGRYCTG
KRAVYRSCSVTPCPANDKSFRHEQCEAKNGYQSDAKGVKTFVEWVPKYAGVLPGDVCKLT
CRAKGTGYYVVFSPKVTDGTECRPYSNSVCVRGKCVRTGCDGIIGSKLQYDKCGVCGGDN
SSCTKVVGTFNKKSKGYTDVVRIPEGATHIKVRQFKAKDQTRFTAYLALKKKNGEYLING
KYMISTSETIIDINGTVMNYSGWSHRDDFLHGMGYSATKEILIVQILATDPTKALDVRYS
FFVPKKSAPKANSVTSQGSNKVGSPTPQLQWVTGPWLACSRTCDTGWHTRTVQCQDGNRK
LAKGCLLSQRPSAFKQCLLKKC
Download sequence
Identical sequences W5PZS2
ENSOARP00000015958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]