SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000015990 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000015990
Domain Number - Region: 12-73
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00418
Family Rad50 coiled-coil Zn hook 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000015990   Gene: ENSOARG00000014906   Transcript: ENSOART00000016223
Sequence length 97
Comment pep:known_by_projection chromosome:Oar_v3.1:20:11425817:11428132:-1 gene:ENSOARG00000014906 transcript:ENSOART00000016223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CTKAKSETFDLYFQIDGLEKKLSQCRRDLEVVNSRLCGAELSSEARRSLEKEKSSLMNKA
SNYEKELKLLRQENRKNMLLSVAIFLLLTVIYAYWAL
Download sequence
Identical sequences W5PZV4
ENSOARP00000015990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]