SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016051 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016051
Domain Number 1 Region: 102-183
Classification Level Classification E-value
Superfamily F-box domain 1.96e-19
Family F-box domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016051   Gene: ENSOARG00000014963   Transcript: ENSOART00000016285
Sequence length 363
Comment pep:novel chromosome:Oar_v3.1:2:101697875:101742417:-1 gene:ENSOARG00000014963 transcript:ENSOART00000016285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFSPSSLPRCTKKDYIRISSYFMMAFAPPKNTNGPKMQTKMSTWTPLNHQLLNDRAFEE
RRALLGKWFDKWTDTQRRRILTSLLERCSLSQQKFCCRKLQEKIPAEALDFTTKLPRVLS
LYIFSFLDPRSLCRCAQVSWHWKNLTELDQLWMLKCLRFNWYINFSPTPYEQGVWKKHYI
QMVKELHVTKPKTPPKDGFVIADVQPIRSSSPGGKLSPSSAFRSSSSLRKKNHPGEKELP
PWRSSDKHPTDIIRFNYLDNRDPIEHSWQGRRKRQEMTPAFNRQSRDKTNKSQERSKLRK
AQSLSSLNAEPRASLHVPAHLAWLPHQPLGLPATEAATKTLTQHLQRLSGLQSSPQAFQQ
QLM
Download sequence
Identical sequences W5Q015
ENSOARP00000016051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]