SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016131 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016131
Domain Number 1 Region: 233-445
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.58e-50
Family Reprolysin-like 0.0011
Further Details:      
 
Domain Number 2 Region: 542-598
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000116
Family TSP-1 type 1 repeat 0.00024
Further Details:      
 
Domain Number 3 Region: 851-903
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000445
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016131   Gene: ENSOARG00000015032   Transcript: ENSOART00000016365
Sequence length 905
Comment pep:known_by_projection chromosome:Oar_v3.1:21:35685217:35702536:-1 gene:ENSOARG00000015032 transcript:ENSOART00000016365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARRPPPRAAPRWPLLLLLLLLLLLPPPLAHGAPARPGGRRPASALVVPKRLQSIAGEVAL
HLSAFGRDLELRLEPDDSFLAPEFKIARLGGSSGAAGSERELRGCIFSGTVNRDPASLAA
VSLCRGLSGTFLLEGQEFTIKPQGAGRSLHQPHLLQRWGHVHPATAAQSLSRASEREAQK
GEGERQARRADPAEEEEKEKQEDDEEGQEEEAESSSEPPPTLEAKSRTKRFVSEDRFVEM
LLVADASMVAFYGEDLESHILMLMSMAARIYKHPSIGNSVNLVMIKLVIMGDEKLGPEVS
DNSGLILRDFCAWQRDVNQPRDRHPEHFDTAVLLTREQNLCGQEGRCDTLGVANVGTICE
PSKSCAVIQDQGLQAAYTLAHELGHVLGMPHDDSKLCTRLFGPLDKHHMMAPLYVQLNKT
RPWSPCSASFLREFLDRGYGDCLLDAPSWAMALPTDLPGRRALYDLDQQCKQIFGLGFRH
CPNSSDQNTCAQLWCRIDGPDPLCHTRNASLPWADGTPCGPGHLCWEGSCLPKEEVEKPE
AVVDGGWAPWGPWGACSRTCGGGVQFSYRECTNPEPQNGGKYCLGQRAKYQSCHTEECPP
DGKSFREQQCEKFNAYNYTDVEGNLLQWVPKYAGVSPRDRCKLFCLARGRSEFRMFEDKV
IDGTLCGPDTLAICVRGQCVKAGCDHVLDSPKKLDKCGVCGGKGDSCRKVSGSFSPSSYG
YNDIVTFPAGSTNIDVKQRSPPGVQNDGNYLALKTTDGEYLLNGNNAIFPTEQYILLNGT
VLRYSGAFTSLERLQSFQSLPQPLTLQLLKVHGDPLKVKYTFFVPDDVYSSKQSSRERTT
TNVIQALLSTQWVLGAWSECSHSCGAGWQRRAVQCRDPSGQTSAACDEALKPEDTKLCRS
LPCFS
Download sequence
Identical sequences W5Q095
ENSOARP00000016131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]