SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016213 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016213
Domain Number 1 Region: 20-146
Classification Level Classification E-value
Superfamily Lysozyme-like 5.63e-47
Family C-type lysozyme 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016213   Gene: ENSOARG00000015113   Transcript: ENSOART00000016447
Sequence length 148
Comment pep:novel chromosome:Oar_v3.1:13:34554500:34572324:-1 gene:ENSOARG00000015113 transcript:ENSOART00000016447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAAGILALMGCLVTVVEPKIYTRCKLAKIFSRASLDNYRGFSLGNWICMAYYESHYNTT
AQTQLKDGSIDYGIFQINSYTWCRNTKLQEKNRCHVACSALLTDDLTDAIICAKKIVKET
DGMNYWQGWKKNCEGRDLSEWKKGCEVS
Download sequence
Identical sequences W5Q0H7
XP_004014324.1.66739 XP_011989510.1.54773 ENSOARP00000016213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]