SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016224 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOARP00000016224
Domain Number - Region: 33-112
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00501
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016224   Gene: ENSOARG00000015121   Transcript: ENSOART00000016458
Sequence length 129
Comment pep:known_by_projection chromosome:Oar_v3.1:19:6835766:6845557:-1 gene:ENSOARG00000015121 transcript:ENSOART00000016458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSLLAFICEEVVSQCTLCGGLYFFEFVSCSAFLLSLLILIVYCTPVYDRVDPAKVKSSD
FYITLGTGLVFFVASIIFALTHDNTVTEIAAIVFGMLASLAYVADFSFILPRKGEAAVRR
EYLTEPLNA
Download sequence
Identical sequences W5Q0I8
ENSOARP00000016224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]