SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOARP00000016235 from Ovis aries 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOARP00000016235
Domain Number 1 Region: 182-393
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.3e-54
Family Reprolysin-like 0.002
Further Details:      
 
Domain Number 2 Region: 481-537
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000432
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 3 Region: 824-871
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000249
Family TSP-1 type 1 repeat 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSOARP00000016235
Domain Number - Region: 798-823
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000432
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOARP00000016235   Gene: ENSOARG00000015132   Transcript: ENSOART00000016469
Sequence length 871
Comment pep:known_by_projection chromosome:Oar_v3.1:21:35728588:35750447:1 gene:ENSOARG00000015132 transcript:ENSOART00000016469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLAGGILMLLLAGAPAGGSEPEREGVVPIRLDPDINGRHYYWQGPEDSRDQGLIFQIT
AFQEDFYLHLTPDAQFLAPAFATEHLGVPLQGLIRSSPDLRRCFYSGDVNAEPDSFAALS
LCGGLRGAFGYRGAEYVISPLPNTSAPAAQRNSQGAHLPSRRIGLGEARSRRRSGRAKRF
VSIPRYVETLVVADESMVKFHGADLEHYLLTLLATAARLYRHPSILNPINIVVVKVLLLG
DRDTGPKVTGNAALTLRNFCAWQKKLNKVSDKHPEYWDTAILFTRQDLCGATTCDTLGMA
DVGTMCDPKRSCSVIEDDGLPSAFTTAHELGHVFNMPHDNVKVCEEVFGKLRGNHMMSPT
LIQIDRANPWSACSAAIVTDFLDSGHGDCLLDQPSKPVSLPEDLPGASYPLSQQCELAFG
VGSKPCPYMQSCTKLWCTGKAKGQMVCQTRHFPWADGTGCGEGRFCLKGACVERHNLNKY
RVDGSWAKWEPYGPCSRTCGGGVQLARRQCSNPTPANGGKYCEGVRVKYRSCNLESCPSS
ASGKSFREEQCEAFNGYNHSTNRLTLAVAWVPKYSGVSPRDKCKLICRANGTGYFYVLAP
KVVDGTPCTPDSTSVCVQGKCIKAGCDGNLGSKKKFDKCGVCGGDNKSCKKVSGLFTKPM
HGYNFVVAIPAGASSIDIRQRGYKGLIGDDNYLALKNSQGKYLLNGHFVVSAVERDLVVK
GSLLRYSGTGTAVESLQASRPILEPLTVEVLSVGKMTPPRVRYSFYLPKEPRVPSVHHNS
VLSLSNQVEQPDAQAPARWVAGSGGPCSASCGGGLQRRPVDCRGSCSKSCGRGFKRRPLK
CMGHGGRLLARDQCDLRRKPQELDFCILRPC
Download sequence
Identical sequences W5Q0J9
ENSOARP00000016235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]